DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and dpr1

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:329 Identity:88/329 - (26%)
Similarity:139/329 - (42%) Gaps:74/329 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WHLHLSCFLLL-LSSTFSDVGKITSSQNHFGNTLQSQFN---TKNNTRVIAQKGGLAILPCVVKV 66
            |.|.||..||. .::..:.....||:.....:.|...|:   .:|.|..:.|.|   .|.|.|:.
  Fly    18 WLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTG---FLHCRVER 79

  Fly    67 NSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPT 131
            .....|||||::|..:||.|.:|::||:||.|.......:|:|:||..:..|.|.||||::..|.
  Fly    80 LGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPK 144

  Fly   132 QSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQGGFVV 196
            .|:.....:||..|||....:|.:...|.:.|.||:.:.......:|||..|:|:  |.:|    
  Fly   145 MSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEML--DGKG---- 203

  Fly   197 TSIGQSNPQSGQFYRSSPANKSRATMPMES--SNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQH 259
                           .:..:.|.|.:.:|.  ::|:                             
  Fly   204 ---------------ENEIDSSMARIRVEDDWTDGL----------------------------- 224

  Fly   260 QSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSILDTETNG 324
                     .|.|.:|:......|||||.|:.|:.:|:.|||:.||..|||||      ::.:|.
  Fly   225 ---------TSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQH------NSSSNS 274

  Fly   325 NGTF 328
            |..:
  Fly   275 NSFY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 30/76 (39%)
IGc2 55..125 CDD:197706 27/69 (39%)
dpr1NP_001286645.1 Ig 59..154 CDD:299845 34/97 (35%)
IG_like 60..150 CDD:214653 34/92 (37%)
IG_like 163..257 CDD:214653 28/152 (18%)
Ig 174..244 CDD:143165 21/128 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.