DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and dpr9

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_996215.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:309 Identity:94/309 - (30%)
Similarity:132/309 - (42%) Gaps:100/309 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TSSQNHFGNTLQSQFN--------------------TKNNTRVIAQKGGLAILPCVVKVNSPAT- 71
            ::|.|.|.:.|.|.|:                    :||.|.::   |..|.|.|.||.....| 
  Fly   227 SASSNTFSSQLASGFHRNSIDLEEARNAGPYFDKAFSKNVTALL---GKTAYLNCRVKNLGNKTM 288

  Fly    72 ---VSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQS 133
               |||:|.:|..|||||..|::||:||...|......|.|:||..:..|.|.||||:|..|..|
  Fly   289 LLQVSWVRHRDIHLLTVGRYTYTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMS 353

  Fly   134 IVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDS------KMINYDS-Q 191
            ..|.|.:||...||..||:|:|:..||:.|.|.::.:.|.||::||.|::      ::||||| :
  Fly   354 HYIHLNVVEPSTEIIGAPDLYIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPR 418

  Fly   192 GGF-VVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYM 255
            ||. |||:.|.:                                                     
  Fly   419 GGVSVVTNKGDT----------------------------------------------------- 430

  Fly   256 TQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRG 304
                        :.|.|.:|......:|:|.|.||||:|.|:|||||.|
  Fly   431 ------------TTSFLLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNG 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 33/80 (41%)
Ig strand B 58..62 CDD:409353 2/3 (67%)
Ig strand C 71..75 CDD:409353 3/7 (43%)
Ig strand E 107..111 CDD:409353 2/3 (67%)
Ig strand F 121..126 CDD:409353 3/4 (75%)
Ig <265..298 CDD:472250 12/32 (38%)
Ig strand E 270..274 CDD:409551 2/3 (67%)
Ig strand F 284..289 CDD:409551 2/4 (50%)
dpr9NP_996215.1 IG_like 263..360 CDD:214653 41/99 (41%)
Ig strand B 274..278 CDD:409355 2/3 (67%)
Ig strand C 291..295 CDD:409355 2/3 (67%)
Ig strand E 327..331 CDD:409355 2/3 (67%)
Ig strand F 341..346 CDD:409355 3/4 (75%)
IG_like 371..464 CDD:214653 38/157 (24%)
Ig strand B 381..385 CDD:143220 1/3 (33%)
Ig strand C 396..400 CDD:143220 1/3 (33%)
Ig strand E 431..437 CDD:143220 2/5 (40%)
Ig strand F 447..452 CDD:143220 2/4 (50%)

Return to query results.
Submit another query.