DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and dpr9

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:309 Identity:94/309 - (30%)
Similarity:132/309 - (42%) Gaps:100/309 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TSSQNHFGNTLQSQFN--------------------TKNNTRVIAQKGGLAILPCVVKVNSPAT- 71
            ::|.|.|.:.|.|.|:                    :||.|.::   |..|.|.|.||.....| 
  Fly   227 SASSNTFSSQLASGFHRNSIDLEEARNAGPYFDKAFSKNVTALL---GKTAYLNCRVKNLGNKTM 288

  Fly    72 ---VSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQS 133
               |||:|.:|..|||||..|::||:||...|......|.|:||..:..|.|.||||:|..|..|
  Fly   289 LLQVSWVRHRDIHLLTVGRYTYTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMS 353

  Fly   134 IVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDS------KMINYDS-Q 191
            ..|.|.:||...||..||:|:|:..||:.|.|.::.:.|.||::||.|::      ::||||| :
  Fly   354 HYIHLNVVEPSTEIIGAPDLYIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPR 418

  Fly   192 GGF-VVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYM 255
            ||. |||:.|.:                                                     
  Fly   419 GGVSVVTNKGDT----------------------------------------------------- 430

  Fly   256 TQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRG 304
                        :.|.|.:|......:|:|.|.||||:|.|:|||||.|
  Fly   431 ------------TTSFLLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNG 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 33/80 (41%)
IGc2 55..125 CDD:197706 31/73 (42%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 41/100 (41%)
IG_like 263..360 CDD:214653 41/99 (41%)
IG_like 371..464 CDD:214653 38/157 (24%)
IGc2 377..456 CDD:197706 30/143 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
65.910

Return to query results.
Submit another query.