DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and NEGR1

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:343 Identity:74/343 - (21%)
Similarity:129/343 - (37%) Gaps:67/343 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAV 114
            ::.:||..|:|.|.:: :..:..:|:.|.  .::..|....|.|.|..:. |.:...:||:|:.|
Human    48 MMVRKGDTAVLRCYLE-DGASKGAWLNRS--SIIFAGGDKWSVDPRVSIS-TLNKRDYSLQIQNV 108

  Fly   115 REEDRGFYECQLSIY---PTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENP-A 175
            ...|.|.|.|.:...   .|..:.:.:::...:.:||:  ::.::|.:.:.|.|   .||..| .
Human   109 DVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISN--DMTVNEGTNVTLTC---LATGKPEP 168

  Fly   176 FVFWYHDSKMINYDSQGGFVVTSIGQSNPQSGQFYRSSPANK-------------SRATMPMESS 227
            .:.|.|.|.... ..:.|..:...|.:..|:|: |..|..|.             :.|....|..
Human   169 SISWRHISPSAK-PFENGQYLDIYGITRDQAGE-YECSAENDVSFPDVRKVKVVVNFAPTIQEIK 231

  Fly   228 NGVLNSLLGSSDAIKAPAANVP-------SSTPYMTQQHQSAYLLNPSV-SVLTVKQVNFRHAGN 284
            :|.:..  |.|..|:...|.||       .....:....|...:.|.|. |:|||..|...|.||
Human   232 SGTVTP--GRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGN 294

  Fly   285 YTCAPSNARPASITVHVLRGEKTAAMQHANRSILDTETNGNGTFGLITLGGLNGTSGVTLAGGIL 349
            |||..:|....:.....|....||..                        |:.|::.|..:...|
Human   295 YTCVAANKLGTTNASLPLNPPSTAQY------------------------GITGSADVLFSCWYL 335

  Fly   350 Y-----FSGLFLLMGAVV 362
            .     |:.:|.|..|::
Human   336 VLTLSSFTSIFYLKNAIL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 20/76 (26%)
IGc2 55..125 CDD:197706 18/69 (26%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 21/90 (23%)
IGc2 152..210 CDD:197706 16/62 (26%)
Ig_3 225..301 CDD:372822 22/77 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.