Sequence 1: | NP_001260336.1 | Gene: | dpr19 / 34408 | FlyBaseID: | FBgn0032233 | Length: | 385 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_647547.2 | Gene: | Lrit1 / 246214 | RGDID: | 628607 | Length: | 623 | Species: | Rattus norvegicus |
Alignment Length: | 258 | Identity: | 56/258 - (21%) |
---|---|---|---|
Similarity: | 94/258 - (36%) | Gaps: | 59/258 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 NSPATVSWIRRKDF-QLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYE--CQLSI 128
Fly 129 YPTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYD---- 189
Fly 190 -----SQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLN--SLLGSSDAIKAPAAN 247
Fly 248 VPSSTPYMTQQHQSAYLLNPSV-----------SVLTVKQVNFRHAGNYTCAPSNARPASITV 299 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr19 | NP_001260336.1 | IG_like | 50..127 | CDD:214653 | 12/62 (19%) |
IGc2 | 55..125 | CDD:197706 | 12/60 (20%) | ||
Lrit1 | NP_647547.2 | LRRNT | 23..61 | CDD:214470 | |
LRR 1 | 60..81 | ||||
LRR_8 | 63..143 | CDD:290566 | 8/44 (18%) | ||
leucine-rich repeat | 64..84 | CDD:275378 | |||
LRR 2 | 84..105 | ||||
leucine-rich repeat | 85..132 | CDD:275378 | 5/14 (36%) | ||
LRR 3 | 108..128 | 3/10 (30%) | |||
LRR_8 | 131..>176 | CDD:290566 | 9/63 (14%) | ||
LRR_4 | 131..172 | CDD:289563 | 9/59 (15%) | ||
LRR 4 | 132..153 | 5/39 (13%) | |||
leucine-rich repeat | 133..156 | CDD:275378 | 5/41 (12%) | ||
LRR 5 | 156..177 | 2/20 (10%) | |||
leucine-rich repeat | 157..180 | CDD:275378 | 2/22 (9%) | ||
leucine-rich repeat | 181..205 | CDD:275378 | 9/33 (27%) | ||
TPKR_C2 | 201..>240 | CDD:301599 | 10/44 (23%) | ||
Ig | 257..345 | CDD:299845 | 22/86 (26%) | ||
IG_like | 267..345 | CDD:214653 | 19/76 (25%) | ||
FN3 | 431..501 | CDD:214495 | |||
LRR 6 | 525..548 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |