Sequence 1: | NP_001260336.1 | Gene: | dpr19 / 34408 | FlyBaseID: | FBgn0032233 | Length: | 385 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_666357.2 | Gene: | Lrit1 / 239037 | MGIID: | 2385320 | Length: | 624 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 44/197 - (22%) |
---|---|---|---|
Similarity: | 72/197 - (36%) | Gaps: | 55/197 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 172 ENPAFVFWYHDSKMINYD----------SQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMES 226
Fly 227 SNGVLN--SLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSV-----------SVLTVKQVN 278
Fly 279 FRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSILDTETNGNGTFGLITLGGLNGTSGVT 343
Fly 344 LA 345 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr19 | NP_001260336.1 | IG_like | 50..127 | CDD:214653 | |
IGc2 | 55..125 | CDD:197706 | |||
Lrit1 | NP_666357.2 | LRRNT | 23..61 | CDD:214470 | |
LRR 1 | 60..81 | ||||
LRR_8 | 63..143 | CDD:290566 | |||
leucine-rich repeat | 64..84 | CDD:275378 | |||
LRR 2 | 84..105 | ||||
leucine-rich repeat | 85..132 | CDD:275378 | |||
LRR 3 | 108..129 | ||||
LRR_8 | 131..>176 | CDD:290566 | |||
LRR_4 | 131..172 | CDD:289563 | |||
LRR 4 | 132..153 | ||||
leucine-rich repeat | 133..156 | CDD:275378 | |||
LRR 5 | 156..177 | ||||
leucine-rich repeat | 157..180 | CDD:275378 | |||
leucine-rich repeat | 181..205 | CDD:275378 | 3/8 (38%) | ||
TPKR_C2 | 201..>241 | CDD:301599 | 10/45 (22%) | ||
Ig | 258..346 | CDD:299845 | 23/104 (22%) | ||
IG_like | 268..346 | CDD:214653 | 20/94 (21%) | ||
FN3 | 432..502 | CDD:214495 | |||
LRR 6 | 526..549 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |