DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and VSIG2

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_055127.2 Gene:VSIG2 / 23584 HGNCID:17149 Length:327 Species:Homo sapiens


Alignment Length:248 Identity:55/248 - (22%)
Similarity:85/248 - (34%) Gaps:64/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LTVGLSTHSSDKRFLVEHTRHMGHWSL--RIKAVREEDRGFYECQLSIYPTQSIVIELKIVEAVA 145
            ||...||...|. |.:|       ||.  ..|.:.|.....|.....:|||.|....:.:::...
Human    43 LTCTYSTSVGDS-FALE-------WSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPP 99

  Fly   146 EISSA----PELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQGGFVVTSIGQSNP-- 204
            .:..|    .::|..:|.|..  |::....:     |:.:...:||       :...:..|||  
Human   100 TVGVATLKLTDVHPSDTGTYL--CQVNNPPD-----FYTNGLGLIN-------LTVLVPPSNPLC 150

  Fly   205 -QSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAAN------VPSSTP-YMTQQHQS 261
             ||||                .|..|.......||:....|..|      .|:.:| .|.|...|
Human   151 SQSGQ----------------TSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVS 199

  Fly   262 AYLLNPSVSVL---TVKQVNFRHAGNYTC-------APSNARPASITVHVLRG 304
            ..|:..::|:.   |.:.|.....|:.:|       .||..|.|...:.||.|
Human   200 GQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVAGALIGVLLG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 12/45 (27%)
Ig strand B 58..62 CDD:409353
Ig strand C 71..75 CDD:409353
Ig strand E 107..111 CDD:409353 2/5 (40%)
Ig strand F 121..126 CDD:409353 1/4 (25%)
Ig <265..298 CDD:472250 9/42 (21%)
Ig strand E 270..274 CDD:409551 1/6 (17%)
Ig strand F 284..289 CDD:409551 1/11 (9%)
VSIG2NP_055127.2 V-set 31..142 CDD:462230 24/120 (20%)
Ig 152..232 CDD:472250 21/95 (22%)
Ig strand B 162..166 CDD:409353 0/3 (0%)
Ig strand C 176..180 CDD:409353 1/3 (33%)
Ig strand E 200..204 CDD:409353 1/3 (33%)
Ig strand F 214..219 CDD:409353 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.