DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and Igsf9b

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:416 Identity:83/416 - (19%)
Similarity:142/416 - (34%) Gaps:107/416 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EPKRWHLHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFN-----TKNNTRVI-AQKGGLAIL 60
            |.:.|:   .|.:|:|...:...        |.|:.:....|     |:...:.| |::||...:
Mouse   108 EDQGWY---ECKVLMLDQQYDTF--------HNGSWVHLTINAPPTFTETPPQYIEAKEGGSITM 161

  Fly    61 PCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQ 125
            .|....|....|:|:  |:..||........||             .||.:.:|..||||.|.|:
Mouse   162 TCTAFGNPKPIVTWL--KEGTLLGASAKYQVSD-------------GSLTVTSVSREDRGAYTCR 211

  Fly   126 LSIYPTQSIVIELKIVEAVAEISSAPE-LHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYD 189
            ......:::.....:|:....|.|.|| :.::.:....|.|:.:....|..:. ||...:.:.:.
Mouse   212 AYSIQGEAVHTTHLLVQGPPFIVSPPENITVNISQDALLTCRAEAYPGNLTYT-WYWQDENVYFQ 275

  Fly   190 S----------QGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAP 244
            :          .|..::..:   .|:....|...|:|.                 ||.|      
Mouse   276 NDLKLRVRILIDGTLIIFRV---KPEDAGKYTCVPSNS-----------------LGRS------ 314

  Fly   245 AANVPSSTPYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITV------HVLR 303
                ||::.|:|.|:.:..|..|.|..:.|      ....|...|.:|.|.:..|      ..|:
Mouse   315 ----PSASAYLTVQYPARVLNMPPVIYVPV------GIHGYIRCPVDAEPPATVVKWNKDGRPLQ 369

  Fly   304 GEKT---AAMQHANRSILDTETNGNGTFGLITLGGLNGTSGVTLAGGIL-----YFSGL------ 354
            .||.   ..|:..:..|.:......||:..:....| ||.|.:....::     ||:.|      
Mouse   370 VEKNLGWTLMEDGSIRIEEATEEALGTYTCVPYNTL-GTMGQSAPARLVLKDPPYFTVLPGWEYR 433

  Fly   355 ------FLLMGAVVFDRFSLAATHKV 374
                  .|:..|...|.|.:....||
Mouse   434 QEAGRELLIPCAAAGDPFPVITWRKV 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 22/77 (29%)
IGc2 55..125 CDD:197706 19/69 (28%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273 3/11 (27%)
I-set 141..227 CDD:369462 23/100 (23%)
Ig 231..323 CDD:386229 20/122 (16%)
Ig <355..416 CDD:386229 12/61 (20%)
Ig 440..504 CDD:319273 6/20 (30%)
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.