DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and IGSF9B

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:407 Identity:81/407 - (19%)
Similarity:144/407 - (35%) Gaps:88/407 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EPKRWHLHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFN-----TKNNTRVI-AQKGGLAIL 60
            |.:.|:   .|.:|:|...:...        |.|:.:....|     |:...:.| |::||...:
Human   106 EDQGWY---ECKVLMLDQQYDTF--------HNGSWVHLTINAPPTFTETPPQYIEAKEGGSITM 159

  Fly    61 PCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQ 125
            .|....|....|:|:  |:..||........||             .||.:.:|..||||.|.|:
Human   160 TCTAFGNPKPIVTWL--KEGTLLGASGKYQVSD-------------GSLTVTSVSREDRGAYTCR 209

  Fly   126 LSIYPTQSIVIELKIVEAVAEISSAPE-LHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYD 189
            ......:::.....:|:....|.|.|| :.::.:....|.|:.:....|..:. ||...:.:.:.
Human   210 AYSIQGEAVHTTHLLVQGPPFIVSPPENITVNISQDALLTCRAEAYPGNLTYT-WYWQDENVYFQ 273

  Fly   190 S----------QGGFVVTSIGQSNPQSGQFYRSSPAN------KSRATMPMESSNGVLNS----- 233
            :          .|..::..:   .|:....|...|:|      .:.|.:.::....|||.     
Human   274 NDLKLRVRILIDGTLIIFRV---KPEDSGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIY 335

  Fly   234 -LLGSSDAIKAPAANVPSST---------PYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCA 288
             .:|....|:.|....|.:|         |...:::....|:..  ..:.:::......|.|||.
Human   336 VPVGIHGYIRCPVDAEPPATVVKWNKDGRPLQVEKNLGWTLMED--GSIRIEEATEEALGTYTCV 398

  Fly   289 PSN-------ARPASITVH------VLRGEKTAAMQHANRSILDTETNGNGTFGLIT---LGGLN 337
            |.|       :.||.:.:.      ||.|.:  ..|.|.|.:|.........|.:||   :|..:
Human   399 PYNTLGTMGQSAPARLVLKDPPYFTVLPGWE--YRQEAGRELLIPCAAAGDPFPVITWRKVGKPS 461

  Fly   338 GTSGVTLAGGILYFSGL 354
            .:....|..|.|.|..|
Human   462 RSKHSALPSGSLQFRAL 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 22/77 (29%)
IGc2 55..125 CDD:197706 19/69 (28%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653 3/11 (27%)
Ig 41..115 CDD:143165 3/11 (27%)
I-set 139..225 CDD:254352 23/100 (23%)
IGc2 153..210 CDD:197706 20/71 (28%)
I-set 229..321 CDD:254352 15/95 (16%)
Ig 235..321 CDD:299845 13/89 (15%)
IG_like 331..414 CDD:214653 15/84 (18%)
Ig <353..414 CDD:299845 11/62 (18%)
IG_like 426..505 CDD:214653 14/55 (25%)
Ig 442..505 CDD:299845 9/37 (24%)
FN3 510..601 CDD:238020
FN3 617..699 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.