DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and CADM4

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_660339.1 Gene:CADM4 / 199731 HGNCID:30825 Length:388 Species:Homo sapiens


Alignment Length:401 Identity:86/401 - (21%)
Similarity:141/401 - (35%) Gaps:119/401 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPC--------VVKVNSPA 70
            ||||.:..:..|.        |..:|::       .|...:||:|.:.|        :|.:.:||
Human    11 LLLLWAAAAGPGA--------GQEVQTE-------NVTVAEGGVAEITCRLHQYDGSIVVIQNPA 60

  Fly    71 TVSWIRRKDFQLLTVGLSTHSSDKRFLVEH--TRHMGHWSLRIKAVREEDRGFYECQLSIYPTQS 133
            .         |.|....:....|:||.:|.  .|.:   .:|:...|.||.|.|.|||....|..
Human    61 R---------QTLFFNGTRALKDERFQLEEFSPRRV---RIRLSDARLEDEGGYFCQLYTEDTHH 113

  Fly   134 IVIELKIVEA----VAEISSAPELHIDETSTLRLECKLKRATENPAFVF-WYHDSKMINYDSQGG 193
            .:..|.::.|    |.|:..    ...|...:.|.|.:.|:  .||... ||.|.|.:...|   
Human   114 QIATLTVLVAPENPVVEVRE----QAVEGGEVELSCLVPRS--RPAATLRWYRDRKELKGVS--- 169

  Fly   194 FVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVL-----NSLLGSS---------DAIKAP 244
                    |:.::|:.:  |.|:..|..:..:...|::     |..|.|.         |...:|
Human   170 --------SSQENGKVW--SVASTVRFRVDRKDDGGIIICEAQNQALPSGHSKQTQYVLDVQYSP 224

  Fly   245 AANVPSSTPYM----TQQHQSAYLLNPSVS--------------------VLTVKQVNFRHAGNY 285
            .|.:.:|...:    |.....|...||..:                    .||:..:.....|.|
Human   225 TARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTY 289

  Fly   286 TCAPSNARPASITVHVLRGEKTAAMQHANRSILDTETNGNGTFGLITLGGLNGTSGVTLAGGILY 350
            ||..||....:..::||......|:..|..|:         .:.::  ||:       ||  :|.
Human   290 TCEASNKHGHARALYVLVVYDPGAVVEAQTSV---------PYAIV--GGI-------LA--LLV 334

  Fly   351 FSGLFLLMGAV 361
            |..:.:|:|.|
Human   335 FLIICVLVGMV 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 23/86 (27%)
Ig strand B 58..62 CDD:409353 1/3 (33%)
Ig strand C 71..75 CDD:409353 0/3 (0%)
Ig strand E 107..111 CDD:409353 0/3 (0%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250 10/52 (19%)
Ig strand E 270..274 CDD:409551 1/23 (4%)
Ig strand F 284..289 CDD:409551 3/4 (75%)
CADM4NP_660339.1 Ig 29..120 CDD:472250 26/109 (24%)
Ig strand B 40..44 CDD:409353 1/3 (33%)
Ig strand C 53..57 CDD:409353 1/3 (33%)
Ig strand E 87..91 CDD:409353 0/6 (0%)
Ig strand F 101..106 CDD:409353 2/4 (50%)
Ig strand G 113..116 CDD:409353 0/2 (0%)
IgI_2_Necl-4 121..220 CDD:409468 23/117 (20%)
Ig strand A 121..124 CDD:409468 0/2 (0%)
Ig strand A' 127..131 CDD:409468 1/3 (33%)
Ig strand B 139..149 CDD:409468 2/9 (22%)
Ig strand C 152..161 CDD:409468 4/8 (50%)
Ig strand C' 162..165 CDD:409468 1/2 (50%)
Ig strand D 167..174 CDD:409468 2/17 (12%)
Ig strand E 177..187 CDD:409468 3/11 (27%)
Ig strand F 195..203 CDD:409468 1/7 (14%)
Ig strand G 212..219 CDD:409468 0/6 (0%)
Ig_3 224..295 CDD:464046 13/70 (19%)
4.1m 344..362 CDD:128590 1/2 (50%)

Return to query results.
Submit another query.