powered by:
Protein Alignment dpr19 and zig-2
DIOPT Version :9
Sequence 1: | NP_001260336.1 |
Gene: | dpr19 / 34408 |
FlyBaseID: | FBgn0032233 |
Length: | 385 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_510069.1 |
Gene: | zig-2 / 192087 |
WormBaseID: | WBGene00006979 |
Length: | 238 |
Species: | Caenorhabditis elegans |
Alignment Length: | 40 |
Identity: | 12/40 - (30%) |
Similarity: | 25/40 - (62%) |
Gaps: | 1/40 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 KRWHLHLSCFLLLLSSTFSDVGKIT-SSQNHFGNTLQSQF 42
:|:.:..|..|::.:.::||:|:.. :::||||.|....|
Worm 192 ERYQMFPSGDLIIRNISWSDMGEYNCTARNHFGETTAITF 231
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3510 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.