DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and zig-4

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:280 Identity:57/280 - (20%)
Similarity:88/280 - (31%) Gaps:101/280 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TLQSQFNTKNNT-----RVIAQKGGLAILP--------CVVKVNSPATVSWIRRKDFQLLTVGLS 88
            ||.::.:|...|     :::|.... |::|        |.:.....||:.|    .|.    |..
 Worm    30 TLANEIDTNYLTSPAKIKIVAPLES-ALIPGGETYQLRCDIMSTPAATIHW----KFN----GKL 85

  Fly    89 THSSDKRFLVEHTRHMGH---------WSLRIKAVREEDRGFYECQLSIYPTQSIVIELKIVEAV 144
            ...|::..:.|...:.|.         ..|.|:....|:.|.|.| :.....|:|       |.|
 Worm    86 IQGSNELNVEEKLLNFGKAIVDTGIVASILTIQCPSAENSGTYSC-VGYNGHQTI-------ETV 142

  Fly   145 AEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQGGFVVTSIGQSNPQSGQF 209
            ||:    |:. .|.|..|...|     ..|..||| .||:.    ...|.|.|.:.::|.|....
 Worm   143 AEV----EIE-GEASGCRSNHK-----SAPEIVFW-TDSRF----EMTGNVATLVCRANQQVDWV 192

  Fly   210 YRSSP---ANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSVSV 271
            :.|:.   .|..:.|:   .|||                                         .
 Worm   193 WMSNDELVKNNDKFTV---LSNG-----------------------------------------D 213

  Fly   272 LTVKQVNFRHAGNYTCAPSN 291
            |.:|.:.:...|.|||...|
 Worm   214 LVIKNIVWDDMGTYTCIARN 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 18/93 (19%)
IGc2 55..125 CDD:197706 16/86 (19%)
zig-4NP_509335.1 I-set 47..147 CDD:254352 24/120 (20%)
Ig 65..144 CDD:143165 19/94 (20%)
IG_like 176..245 CDD:214653 18/102 (18%)
Ig <193..238 CDD:299845 13/85 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.