DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and zig-8

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:289 Identity:51/289 - (17%)
Similarity:93/289 - (32%) Gaps:93/289 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAV 114
            |:|:..  |.|.|.|..::...::|.|..|..|||.|..|.:.|.|:.|. .:....|.|.::..
 Worm    47 VVAENP--AYLHCSVPPDAEHEIAWTRVSDGALLTAGNRTFTRDPRWQVS-KKSANIWVLNLRRA 108

  Fly   115 REEDRGFYECQLSIYPTQSIVIELKIVEAVAEISSAPELHIDETSTLR--------LECKLKRA- 170
            .::|.|.|.|:::........:.||::|  ..:.|...|....|..:.        |.|.:... 
 Worm   109 EQQDSGCYLCEINDKHNTVYAVYLKVLE--PPLPSPSSLQKKSTKLMANMSGDEVVLNCTVTSTD 171

  Fly   171 -TENPAFVFWYHDSKMINYDSQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSL 234
             .|....|.|..|...||::....:::                                      
 Worm   172 KDEEVLDVVWTRDGNTINFNDTEKYIL-------------------------------------- 198

  Fly   235 LGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITV 299
                 .:|..|..|                    :..:.:::......|||.|..|.        
 Worm   199 -----KVKRDAGVV--------------------IETMRIRKATMEDDGNYACEHSQ-------- 230

  Fly   300 HVLRGEKTAAMQHANRSILDTETNGNGTF 328
                 :|.:.:.|.|::  :.:|:.:.||
 Worm   231 -----QKASQIVHINKA--EAQTSNSATF 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 23/76 (30%)
IGc2 55..125 CDD:197706 20/69 (29%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653 21/79 (27%)
Ig 55..129 CDD:143165 20/74 (27%)
ig 158..229 CDD:278476 15/133 (11%)
IG_like 158..227 CDD:214653 14/131 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.