DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and rig-5

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:307 Identity:69/307 - (22%)
Similarity:110/307 - (35%) Gaps:72/307 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMG----HWSLRIKAVREEDRGFYEC 124
            ||.:||..:.....|.|:            :|...|....:|    .|.|.||.|:|.|||.|.|
 Worm   119 VKADSPPRLLSFDEKVFR------------RRNKYELKPRIGDLHNEWVLTIKNVQESDRGNYSC 171

  Fly   125 QLSIYPTQSIVIELKI-VEAVAEISSAPELHIDETSTLRLECKLKRATENPA-FVFW-YHDSKMI 186
            |::..|......||.: |..|...|:...:.:.|.:.:.|.||   |..||. .|.| ..|.::|
 Worm   172 QINTEPITLSTGELDVKVPPVVSRSTPAAVEVREGNNVSLTCK---ADGNPTPTVIWRRQDRQII 233

  Fly   187 NYDSQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGV-------LNSLLGSSDAIKAP 244
            .|:...||     |.|.......:.:..:.|..:.....:|||:       :..|:.....::|.
 Worm   234 RYNGATGF-----GASVFHGPVLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLVTFPPLVQAQ 293

  Fly   245 AANVPSSTPYMT-----------------QQHQSAYLLN------------PSVSVLTVKQVNFR 280
            :..|.:|...|.                 :..:..|..|            .||.:|.::.|...
 Worm   294 SETVQASVGSMARMVCTTEAWPRPEMGWEKDGEPVYESNNVAMTHTVSGQYHSVHILEIRNVQSS 358

  Fly   281 HAGNYTCAPSN---ARPASITVHVLRGEKTAAMQHANRSILDTETNG 324
            |.|.|.|...|   ...:.:|::.:      :..|...|.|..|.:|
 Worm   359 HFGVYRCVAKNDNGIHHSQVTLNQI------SHNHFTNSNLIPEGSG 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 21/66 (32%)
Ig strand B 58..62 CDD:409353
Ig strand C 71..75 CDD:409353 0/3 (0%)
Ig strand E 107..111 CDD:409353 2/3 (67%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250 10/47 (21%)
Ig strand E 270..274 CDD:409551 1/3 (33%)
Ig strand F 284..289 CDD:409551 2/4 (50%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 24/81 (30%)
Ig strand B 102..106 CDD:409353
Ig strand C 118..122 CDD:409353 2/2 (100%)
Ig strand E 154..158 CDD:409353 2/3 (67%)
Ig strand F 168..173 CDD:409353 2/4 (50%)
Ig_3 190..270 CDD:464046 19/87 (22%)
Ig_3 287..369 CDD:464046 14/81 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.