DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and LOC1282038

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_061500784.1 Gene:LOC1282038 / 1282038 VectorBaseID:AGAMI1_009918 Length:467 Species:Anopheles gambiae


Alignment Length:156 Identity:36/156 - (23%)
Similarity:70/156 - (44%) Gaps:29/156 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HLHLSCFLLLLSSTF-SDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPA 70
            ||.:...|::::|.| ::|.:|....|...:.:..|...::..::....|..     ::||:|.|
Mosquito   227 HLLVGVSLIIITSIFYAEVYEIRYRLNAVNSHISKQLCDEDFHKLRPNYGRR-----MIKVSSNA 286

  Fly    71 TVSWIRRKDFQLLTVGL---STHS----SDKRFLVEHTRHMGHWSLR----IKAV----REEDRG 120
            .:.  .|||| :..|||   ..||    ...|:|.|.:   |:..:.    |.||    |.....
Mosquito   287 EIK--LRKDF-IARVGLIYEELHSIATKISNRYLFEFS---GYCIVNVFYGIMAVYIFYRAVFIT 345

  Fly   121 FYECQ--LSIYPTQSIVIELKIVEAV 144
            |||.:  :||:...:::.::.:.:.:
Mosquito   346 FYEARYSISIFLVWALIYKISLFQMI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 25/93 (27%)
Ig strand B 58..62 CDD:409353 0/3 (0%)
Ig strand C 71..75 CDD:409353 0/3 (0%)
Ig strand E 107..111 CDD:409353 0/7 (0%)
Ig strand F 121..126 CDD:409353 3/6 (50%)
Ig <265..298 CDD:472250
Ig strand E 270..274 CDD:409551
Ig strand F 284..289 CDD:409551
LOC1282038XP_061500784.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.