DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and Cd86

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_006521804.1 Gene:Cd86 / 12524 MGIID:101773 Length:314 Species:Mus musculus


Alignment Length:174 Identity:43/174 - (24%)
Similarity:72/174 - (41%) Gaps:34/174 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QSQFNTKNNTRVIAQKGGLAILPC-VVKVN----SPATVSWIRRKDFQLLTVGLSTHSSDK---R 95
            |:.||            |.|.||| ..|..    |...|.|..::...|....|.|...|.   :
Mouse    34 QAYFN------------GTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAK 86

  Fly    96 FLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIY-PTQSIVIELKIVE-AVAEISSAPELHIDET 158
            :|...:....:|:||:..|:.:|.|.|:|.:... ||.||:::..:.| :|....|.||:.:.:.
Mouse    87 YLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQN 151

  Fly   159 ST----LRLECKLKRATENPAFVFW--------YHDSKMINYDS 190
            .|    :.|.|..|:....|..:::        |.|:..|:.|:
Mouse   152 VTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDN 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 22/84 (26%)
Ig strand B 58..62 CDD:409353 2/3 (67%)
Ig strand C 71..75 CDD:409353 1/3 (33%)
Ig strand E 107..111 CDD:409353 2/3 (67%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250
Ig strand E 270..274 CDD:409551
Ig strand F 284..289 CDD:409551
Cd86XP_006521804.1 IgV_CD86 31..138 CDD:409508 30/115 (26%)
FR1 31..45 CDD:409508 6/22 (27%)
Ig strand A 31..36 CDD:409508 1/1 (100%)
Ig strand B 39..45 CDD:409508 3/5 (60%)
CDR1 46..57 CDD:409508 1/10 (10%)
FR2 58..65 CDD:409508 2/6 (33%)
Ig strand C 58..64 CDD:409508 2/5 (40%)
CDR2 67..87 CDD:409508 4/19 (21%)
Ig strand C' 69..74 CDD:409508 1/4 (25%)
Ig strand C' 77..79 CDD:409508 1/1 (100%)
FR3 88..120 CDD:409508 9/31 (29%)
Ig strand D 90..94 CDD:409508 0/3 (0%)
Ig strand E 98..104 CDD:409508 3/5 (60%)
Ig strand F 111..119 CDD:409508 3/7 (43%)
CDR3 121..123 CDD:409508 0/1 (0%)
FR4 124..138 CDD:409508 3/13 (23%)
Ig strand G 125..138 CDD:409508 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.