DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and Opcml

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:338 Identity:78/338 - (23%)
Similarity:130/338 - (38%) Gaps:68/338 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAV 114
            |..::|..|.|.|.:. :....|:|:.|.  .:|..|....|.|.|.:: .......:|:.|:.|
  Rat    45 VTVRQGESATLRCTID-DRVTRVAWLNRS--TILYAGNDKWSIDPRVII-LVNTPTQYSIMIQNV 105

  Fly   115 REEDRGFYEC--QLSIYP-TQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAF 176
            ...|.|.|.|  |...:| |..:.:.:::...:..|||  ::.::|.|::.|.| |......|. 
  Rat   106 DVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISS--DITVNEGSSVTLLC-LAIGRPEPT- 166

  Fly   177 VFWYHDSKMINYDSQGGFV-------VTSIGQSNPQSGQFYRSSPAN--------KSRATM---P 223
            |.|.|    ::.....|||       ::.|  ...|||: |..|..|        |.:.|:   |
  Rat   167 VTWRH----LSVKEGQGFVSEDEYLEISDI--KRDQSGE-YECSALNDVAAPDVRKVKITVNYPP 224

  Fly   224 MESSNGVLNSLLGSSDAIKAPAANVP-SSTPYMTQQHQSAYLLN-------PSVSVLTVKQVNFR 280
            ..|........:|....:...|:.|| :...:..:..:.|..|:       ..:|.||...|:.:
  Rat   225 YISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENKGRISTLTFFNVSEK 289

  Fly   281 HAGNYTCAPSNA---RPASITVHVLRGEKTAAMQHANRSILDTETNGNGTFGLITLGGLNGTSGV 342
            ..|||||..:|.   ..||||::.:......|              |.|..       ::|.:..
  Rat   290 DYGNYTCVATNKLGNTNASITLYEISPSSAVA--------------GPGAV-------IDGVNSA 333

  Fly   343 TLAGGILYFSGLF 355
            :.|...|:.||.|
  Rat   334 SRALACLWLSGTF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 21/78 (27%)
Ig strand B 58..62 CDD:409353 2/3 (67%)
Ig strand C 71..75 CDD:409353 1/3 (33%)
Ig strand E 107..111 CDD:409353 1/3 (33%)
Ig strand F 121..126 CDD:409353 2/6 (33%)
Ig <265..298 CDD:472250 13/42 (31%)
Ig strand E 270..274 CDD:409551 2/3 (67%)
Ig strand F 284..289 CDD:409551 4/4 (100%)
OpcmlXP_017450901.1 Ig 44..132 CDD:472250 23/90 (26%)
Ig strand B 53..57 CDD:409353 2/3 (67%)
Ig strand C 65..69 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig_3 135..206 CDD:464046 21/81 (26%)
Ig 224..312 CDD:472250 22/87 (25%)
Ig strand B 240..244 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 2/3 (67%)
Ig strand F 293..298 CDD:409353 4/4 (100%)
Ig strand G 306..309 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.