DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and ntm

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:332 Identity:80/332 - (24%)
Similarity:138/332 - (41%) Gaps:67/332 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKR-FLVEHTRHMGHWSLRIKA 113
            |..::|..|||.|.|. |....|:|:.|.  .:|..|....|.|.| .|:.:|:  ..:|:.|:.
 Frog    46 VTVRQGDSAILRCTVD-NRVTRVAWLNRS--TILYTGNDKWSIDPRVVLLANTK--SQYSIEIQN 105

  Fly   114 VREEDRGFYEC--QLSIYP-TQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPA 175
            |...|.|.|.|  |...:| |..:.:.:::...:.:|||:  :.::|.|.:.|.| :......|.
 Frog   106 VDIYDEGPYTCSVQTDNHPKTSRVHLIVQVPPRIVDISSS--IAVNEGSNVSLIC-IANGRPEPV 167

  Fly   176 FVFWYHDSKMINYDSQGGFV-VTSIGQSNPQSGQFYRSSPAN----------KSRATMP---MES 226
            ..:.|...|...:.|:..:: :|.|  :..||| .|..|.:|          |.....|   :::
 Frog   168 VNWRYLSPKARGFVSEDEYLEITGI--TREQSG-IYECSASNDVSAPDVRRVKLTVNYPPYILDA 229

  Fly   227 SNGVLNSLLGSSDAIKAPAANVPSSTPY-------MTQQHQSAYLLN-PSVSVLTVKQVNFRHAG 283
            .|  :.:.||....::..|:.||::..:       ::...:...:.| .::|.:|...|:.:..|
 Frog   230 QN--IGAPLGHRGILQCEASAVPAADFFWYKEDKRLSDSWRGVKVENRETISRVTFLNVSEQDYG 292

  Fly   284 NYTCAPSNA---RPASITVH---------VLRGEKTAAMQHANRSILDTETNGNGTFGLITLGGL 336
            ||||...|.   ..|||.:.         :|:.|.|||:         |...|.|...       
 Frog   293 NYTCMAKNLLGHSNASIILFELFQSTSSPLLQEESTAAL---------TPLKGPGAVH------- 341

  Fly   337 NGTSGVT 343
            :|.||.|
 Frog   342 DGNSGST 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 26/79 (33%)
IGc2 55..125 CDD:197706 24/72 (33%)
ntmXP_004916061.1 Ig 45..133 CDD:299845 28/91 (31%)
IG_like 45..133 CDD:214653 28/91 (31%)
IG_like 143..220 CDD:214653 19/82 (23%)
IGc2 150..209 CDD:197706 16/62 (26%)
ig 227..311 CDD:278476 19/85 (22%)
IG_like 230..311 CDD:214653 19/82 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.