DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and cd86

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_017946874.1 Gene:cd86 / 100486350 XenbaseID:XB-GENE-22065593 Length:319 Species:Xenopus tropicalis


Alignment Length:229 Identity:51/229 - (22%)
Similarity:86/229 - (37%) Gaps:51/229 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GGLAILPCVVKVNSPATVSWIRRKDF----QLLTV-----GLS--THSSDK---RFLVEHTRHMG 105
            ||.|.|.|     ||:|...:::..|    ::.|:     |:.  .|..||   |..::.     
 Frog    33 GGTAGLKC-----SPSTNLSLQKPSFYWQNEVETIFNVDDGVPDLQHVKDKYKNRIALKE----- 87

  Fly   106 HWSLRIKAVREEDRGFYECQLSIYPT------QSIVIELKIVE--AVAEISSAPELHIDETSTLR 162
            :|.|.:..|..||.|.|...: |..|      ...|..||:..  :..|..|:|..:........
 Frog    88 NWDLYLHNVTVEDEGEYSNYI-IKKTPWREHAHICVFRLKVRAHFSPTESHSSPTHNTTRGEDKT 151

  Fly   163 LECKLKRATENPAFVFWYHDSKMINYDSQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESS 227
            |||.|......|:.:.|    :::|  |.|.|.:    :.|....:...:...|.|.:...|...
 Frog   152 LECSLAGGYPKPSGLMW----RVVN--SSGTFTM----KENFSISEDVETKLYNISSSLSVMVEG 206

  Fly   228 NGVLNSLL----GSSD----AIKAPAANVPSSTP 253
            |..::.|:    .::|    :|.....|:.|:.|
 Frog   207 NTTISCLILKGGQTTDTYEFSIIVDPENISSTVP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 22/85 (26%)
IGc2 55..125 CDD:197706 22/83 (27%)
cd86XP_017946874.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051626at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.