DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and timd4

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001116089.3 Gene:timd4 / 100142639 ZFINID:ZDB-GENE-080303-10 Length:259 Species:Danio rerio


Alignment Length:147 Identity:31/147 - (21%)
Similarity:61/147 - (41%) Gaps:18/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KGGLAILPC--VVKVNSPATVSWIRR------KDFQLLT--VGLSTHSSDKRFLVEHTRHMGHWS 108
            :|...||.|  .||.:..:.|.|.|.      .|..:.|  .|:.:..||:..|:.... :|...
Zfish    32 EGSTVILSCHYSVKHHGLSHVCWGRDCGTFWCNDIIVQTDEYGVISKVSDRYRLIGDVM-LGQMD 95

  Fly   109 LRIKAVREEDRGFYECQLSI---YPTQSIVIELKIVEAVAEISSAPELHID----ETSTLRLECK 166
            |.|:.:::.|.|.|.|::.|   :..:.:...|::::|...::......|.    ||.|..|...
Zfish    96 LGIQKIQKSDSGPYCCRVDIEGFFNDKKMSYTLQVMKAPTTVAPKTTTQITTEPMETQTASLSDP 160

  Fly   167 LKRATENPAFVFWYHDS 183
            .:....:...:.|.:::
Zfish   161 SRGGDSSLNDISWQNET 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 22/82 (27%)
Ig strand B 58..62 CDD:409353 2/3 (67%)
Ig strand C 71..75 CDD:409353 1/3 (33%)
Ig strand E 107..111 CDD:409353 1/3 (33%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250
Ig strand E 270..274 CDD:409551
Ig strand F 284..289 CDD:409551
timd4NP_001116089.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.