| Sequence 1: | NP_001260336.1 | Gene: | dpr19 / 34408 | FlyBaseID: | FBgn0032233 | Length: | 385 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031755650.1 | Gene: | negr1 / 100127726 | XenbaseID: | XB-GENE-987949 | Length: | 388 | Species: | Xenopus tropicalis |
| Alignment Length: | 283 | Identity: | 69/283 - (24%) |
|---|---|---|---|
| Similarity: | 116/283 - (40%) | Gaps: | 42/283 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 35 GNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVE 99
Fly 100 HTRHMGHWSLRIKAVREEDRGFYEC--QLSIYP-TQSIVIELKIVEAVAEISSAPELHIDETSTL 161
Fly 162 RLECKLKRATENP-AFVFWYHDSKMINYDSQGGFVVTSIGQSNPQSGQFYRSSPAN--------K 217
Fly 218 SRATMPME------SSNGVLNSLLGSSDAIKAPAANVPS-------STPYMTQQHQSAYLLNPSV 269
Fly 270 -SVLTVKQVNFRHAGNYTCAPSN 291 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr19 | NP_001260336.1 | IG_like | 50..127 | CDD:214653 | 21/78 (27%) |
| IGc2 | 55..125 | CDD:197706 | 20/71 (28%) | ||
| negr1 | XP_031755650.1 | Ig | 44..136 | CDD:416386 | 24/97 (25%) |
| FR1 | 44..62 | CDD:409353 | 4/19 (21%) | ||
| Ig strand A' | 47..53 | CDD:409353 | 1/7 (14%) | ||
| Ig strand B | 55..63 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 63..68 | CDD:409353 | 0/5 (0%) | ||
| FR2 | 69..75 | CDD:409353 | 1/5 (20%) | ||
| Ig strand C | 69..74 | CDD:409353 | 1/4 (25%) | ||
| CDR2 | 76..87 | CDD:409353 | 1/12 (8%) | ||
| Ig strand C' | 78..82 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 84..87 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 88..122 | CDD:409353 | 12/34 (35%) | ||
| Ig strand D | 91..98 | CDD:409353 | 2/7 (29%) | ||
| Ig strand E | 101..107 | CDD:409353 | 3/5 (60%) | ||
| Ig strand F | 114..122 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 123..127 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 127..136 | CDD:409353 | 2/8 (25%) | ||
| FR4 | 129..136 | CDD:409353 | 1/6 (17%) | ||
| Ig_3 | 140..208 | CDD:404760 | 18/74 (24%) | ||
| Ig strand A' | 146..151 | CDD:409353 | 2/6 (33%) | ||
| Ig strand B | 157..164 | CDD:409353 | 2/9 (22%) | ||
| Ig strand C | 170..175 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 177..179 | CDD:409353 | 1/1 (100%) | ||
| Ig strand E | 187..193 | CDD:409353 | 0/6 (0%) | ||
| Ig strand F | 200..207 | CDD:409353 | 3/7 (43%) | ||
| Ig strand G | 214..222 | CDD:409353 | 1/7 (14%) | ||
| Ig_3 | 226..302 | CDD:404760 | 21/78 (27%) | ||
| putative Ig strand A | 226..232 | CDD:409353 | 0/5 (0%) | ||
| Ig strand B | 242..246 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 255..259 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 281..285 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 295..300 | CDD:409353 | 4/4 (100%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||