DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and negr1

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:283 Identity:69/283 - (24%)
Similarity:116/283 - (40%) Gaps:42/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVE 99
            |.::..|:...:|  ::.::|..|:|.|.:: ...:..:|:.|.  .::..|....|.|.|..:.
 Frog    36 GQSMDFQWPAVDN--LVVRQGETAMLRCFLE-EGASKGAWLNRS--SIIFAGGDKWSVDPRVSIA 95

  Fly   100 HTRHMGHWSLRIKAVREEDRGFYEC--QLSIYP-TQSIVIELKIVEAVAEISSAPELHIDETSTL 161
             |.....:||||:.|...|.|.|.|  |....| |..:.:.:.:...:.:|||  ::.::|.:.:
 Frog    96 -TSSKQEYSLRIQKVDVSDDGPYTCSVQTEHSPRTLQVHLTVHVSPKIYDISS--DMTVNEGTNV 157

  Fly   162 RLECKLKRATENP-AFVFWYHDSKMINYDSQGGFVVTSIGQSNPQSGQFYRSSPAN--------K 217
            .|.|   .||..| ..:.|.|.|........|.: :...|.:..|:|. |..|..|        |
 Frog   158 SLIC---LATGKPEPSISWRHISPSAKQFGSGQY-LDIYGITRDQAGD-YECSAENDVSFPDVKK 217

  Fly   218 SRATMPME------SSNGVLNSLLGSSDAIKAPAANVPS-------STPYMTQQHQSAYLLNPSV 269
            .:.|:...      :..||   .||.:..|:...|.||:       ....:|...:...:.|.:.
 Frog   218 VKVTVNFAPTILEITPTGV---SLGRTGLIRCETAAVPAPVFEWYKGEKKLTNGQRGIRIQNYNT 279

  Fly   270 -SVLTVKQVNFRHAGNYTCAPSN 291
             |:|||..|...|.|||||...|
 Frog   280 RSILTVSNVTEEHFGNYTCVAVN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 21/78 (27%)
Ig strand B 58..62 CDD:409353 2/3 (67%)
Ig strand C 71..75 CDD:409353 0/3 (0%)
Ig strand E 107..111 CDD:409353 2/3 (67%)
Ig strand F 121..126 CDD:409353 2/6 (33%)
Ig <265..298 CDD:472250 13/28 (46%)
Ig strand E 270..274 CDD:409551 2/3 (67%)
Ig strand F 284..289 CDD:409551 4/4 (100%)
negr1XP_031755650.1 Ig 44..136 CDD:472250 24/97 (25%)
Ig strand B 57..61 CDD:409353 2/3 (67%)
Ig strand C 70..73 CDD:409353 0/2 (0%)
Ig strand E 102..106 CDD:409353 2/3 (67%)
Ig strand F 116..121 CDD:409353 2/4 (50%)
Ig strand G 129..132 CDD:409353 1/2 (50%)
Ig 146..222 CDD:472250 19/82 (23%)
Ig strand B 157..161 CDD:409301 1/3 (33%)
Ig strand C 170..174 CDD:409301 0/3 (0%)
Ig strand E 187..191 CDD:409301 0/4 (0%)
Ig strand F 201..206 CDD:409301 1/5 (20%)
Ig strand G 215..218 CDD:409301 0/2 (0%)
Ig_3 226..302 CDD:464046 21/78 (27%)

Return to query results.
Submit another query.