DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lft and lix1

DIOPT Version :9

Sequence 1:NP_001188775.1 Gene:lft / 34405 FlyBaseID:FBgn0032230 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001313325.1 Gene:lix1 / 558010 ZFINID:ZDB-GENE-060526-123 Length:290 Species:Danio rerio


Alignment Length:251 Identity:133/251 - (52%)
Similarity:179/251 - (71%) Gaps:9/251 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EDRDYR-VNVVEALQEFWQMKQSRGAELKNGALVIYESIPSNSQPYICFVTLPGGSCFGSFQNCP 82
            :||.:: :|||..|.:||:.||:.|..::...||:||||||.|.|:||:||||||||||:|::|.
Zfish     8 DDRAFKDLNVVGMLHKFWEQKQAAGVMMEIENLVVYESIPSPSPPFICYVTLPGGSCFGNFKHCY 72

  Fly    83 TKAEARRSSAKIALMNSVFNEHPSRRISDEFIQKAVQDARTSFKGTSQINEGTESGIGAFRFMLE 147
            :||||||.:|::|||||.|||.|.|||:.|||..:|::|.::..|.........:.|||:..|||
Zfish    73 SKAEARRDAARVALMNSTFNELPCRRITPEFISHSVKEAVSTTSGNIADASDPSTSIGAYCLMLE 137

  Fly   148 ANKGRTMLEFQELMTVFQLLHWNGSLKAMRERHCSRQEVVAHYSNRSLDDEMRSQMALDWIAREH 212
            .|.|:|||||||:|||||||||||:|||.|:..||||||:.:||.:.||:..||.|||||:.:|.
Zfish   138 LNTGKTMLEFQEIMTVFQLLHWNGTLKAFRDMRCSRQEVIQYYSQQRLDERTRSHMALDWLQKEL 202

  Fly   213 DNPGVIRRELVLAERELETFRMAGRELRFPKEKKDILMIAHNQLGGSALNSATIDD 268
            .:||::.:||.||.:||...|..||||||.||||:||.:        ||:.|..:|
Zfish   203 QSPGLLSQELQLAVKELGEARRTGRELRFYKEKKEILSL--------ALSHADAED 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lftNP_001188775.1 LIX1 24..255 CDD:291615 127/231 (55%)
lix1NP_001313325.1 LIX1 6..245 CDD:291615 131/244 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596534
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CB0Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1026341at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106706
Panther 1 1.100 - - O PTHR31139
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.