DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lft and Epg5

DIOPT Version :9

Sequence 1:NP_001188775.1 Gene:lft / 34405 FlyBaseID:FBgn0032230 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_650752.2 Gene:Epg5 / 42256 FlyBaseID:FBgn0038651 Length:2455 Species:Drosophila melanogaster


Alignment Length:170 Identity:34/170 - (20%)
Similarity:64/170 - (37%) Gaps:38/170 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YPEEPFWVLPTVTGFYEDRDYRVNVVEALQEFWQMKQSRGAELKNGALVIYESIPSNSQPYIC-- 65
            :|.||...:|.:.        |:.::     |..:.::|...|..|.||   |:..:|.|.||  
  Fly   894 HPTEPLLFIPELE--------RMEMI-----FQGVNENRPLALYVGMLV---SLHGHSIPLICQH 942

  Fly    66 -FVTLPGGSCFGSFQNCPTKAEARRSSAKIALMNSVFNEHPSRRISDEFIQKAVQDARTSFKGTS 129
             |:.|         |..........:...:.|:..:|.|.|....:.|..|:.:         |:
  Fly   943 GFILL---------QQLLLDHRHAATIRCLELIVPLFLETPETLANCESFQRLI---------TT 989

  Fly   130 QINEGTESGIGAFRFMLEANKGRTMLEFQELMTVFQLLHW 169
            .:| ...:.:...:.|:.||....:||..:.|...|::.:
  Fly   990 LLN-ADRTYLKLAKDMVYANSIGPILELLDNMLHHQIISY 1028

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lftNP_001188775.1 LIX1 24..255 CDD:291615 30/149 (20%)
Epg5NP_650752.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468116
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31139
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.