DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lft and Lix1

DIOPT Version :9

Sequence 1:NP_001188775.1 Gene:lft / 34405 FlyBaseID:FBgn0032230 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001099684.1 Gene:Lix1 / 292381 RGDID:1309454 Length:282 Species:Rattus norvegicus


Alignment Length:244 Identity:137/244 - (56%)
Similarity:185/244 - (75%) Gaps:0/244 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VNVVEALQEFWQMKQSRGAELKNGALVIYESIPSNSQPYICFVTLPGGSCFGSFQNCPTKAEARR 89
            :|||..|||||:.||.:.|...:..||:|||:||:..|::.:||||||||||:||.|.::|||||
  Rat    28 LNVVSMLQEFWESKQQQRATFSSEGLVVYESMPSSGPPFVSYVTLPGGSCFGNFQCCLSRAEARR 92

  Fly    90 SSAKIALMNSVFNEHPSRRISDEFIQKAVQDARTSFKGTSQINEGTESGIGAFRFMLEANKGRTM 154
            .:||:||:||:|||.|||||:.|||.::||:|..|.:||....:...:.:||:.:|||:|.|:||
  Rat    93 DAAKVALINSLFNELPSRRITKEFIMESVQEAVASTRGTLDDADDPSTSVGAYHYMLESNMGKTM 157

  Fly   155 LEFQELMTVFQLLHWNGSLKAMRERHCSRQEVVAHYSNRSLDDEMRSQMALDWIAREHDNPGVIR 219
            ||||||||:||||||||||||:||..||||||:::||..|||::|||.||||||.:|.::||::.
  Rat   158 LEFQELMTIFQLLHWNGSLKALRETKCSRQEVISYYSQYSLDEKMRSHMALDWIMKERESPGILS 222

  Fly   220 RELVLAERELETFRMAGRELRFPKEKKDILMIAHNQLGGSALNSATIDD 268
            :||..|..:||..|.||:||||.||||:||.:|..|:......|:..||
  Rat   223 QELRAALGQLEEARKAGQELRFYKEKKEILSLALTQIYCDPDPSSPSDD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lftNP_001188775.1 LIX1 24..255 CDD:291615 133/229 (58%)
Lix1NP_001099684.1 LIX1 17..258 CDD:291615 133/229 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354259
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CB0Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1026341at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106706
Panther 1 1.100 - - O PTHR31139
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.