DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lft and lix1

DIOPT Version :9

Sequence 1:NP_001188775.1 Gene:lft / 34405 FlyBaseID:FBgn0032230 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_002933479.1 Gene:lix1 / 100497418 XenbaseID:XB-GENE-976693 Length:281 Species:Xenopus tropicalis


Alignment Length:257 Identity:146/257 - (56%)
Similarity:190/257 - (73%) Gaps:6/257 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PTVTGFYEDRDYRVNVVEALQEFWQMKQSRGAELKNGALVIYESIPSNSQPYICFVTLPGGSCFG 76
            ||:  .::|    :|||..|||||:.|:.|.|...:.:||.|||:||...|::|:||||||||||
 Frog    21 PTI--IFKD----LNVVALLQEFWENKEKRRAVFPSESLVAYESVPSPDPPFVCYVTLPGGSCFG 79

  Fly    77 SFQNCPTKAEARRSSAKIALMNSVFNEHPSRRISDEFIQKAVQDARTSFKGTSQINEGTESGIGA 141
            :||.|.::|||||.:||:||:||:|||.|||||:.:||.|:||:|.:|..|.....:...:.:||
 Frog    80 NFQCCLSRAEARRDAAKVALLNSLFNELPSRRITTDFIMKSVQEAVSSTSGNILDADDPSTSVGA 144

  Fly   142 FRFMLEANKGRTMLEFQELMTVFQLLHWNGSLKAMRERHCSRQEVVAHYSNRSLDDEMRSQMALD 206
            :.:|||.|.|:|||||||||.|||||||||||||:||..||||||:|:||..|||:.|||.||||
 Frog   145 YHYMLETNVGKTMLEFQELMIVFQLLHWNGSLKALRETKCSRQEVIAYYSQYSLDERMRSHMALD 209

  Fly   207 WIAREHDNPGVIRRELVLAERELETFRMAGRELRFPKEKKDILMIAHNQLGGSALNSATIDD 268
            ||.:|.:.||:|.:||.||.||||..|.|||||||.||||:||.:|.:.:.|..:.|:.|.|
 Frog   210 WIMKEEEAPGIISQELQLALRELEESRKAGRELRFYKEKKEILGLALSHIYGDCITSSRIPD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lftNP_001188775.1 LIX1 24..255 CDD:291615 139/230 (60%)
lix1XP_002933479.1 LIX1 17..258 CDD:373420 142/242 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1026341at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.