DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lft and lix1l

DIOPT Version :9

Sequence 1:NP_001188775.1 Gene:lft / 34405 FlyBaseID:FBgn0032230 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_031746876.1 Gene:lix1l / 100489293 XenbaseID:XB-GENE-6040737 Length:331 Species:Xenopus tropicalis


Alignment Length:234 Identity:176/234 - (75%)
Similarity:207/234 - (88%) Gaps:0/234 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RVNVVEALQEFWQMKQSRGAELKNGALVIYESIPSNSQPYICFVTLPGGSCFGSFQNCPTKAEAR 88
            ||||||||||||||||:|||||||||||:||.:||||.||:|:|||||||||||||.||||||||
 Frog    91 RVNVVEALQEFWQMKQTRGAELKNGALVVYEMVPSNSPPYVCYVTLPGGSCFGSFQFCPTKAEAR 155

  Fly    89 RSSAKIALMNSVFNEHPSRRISDEFIQKAVQDARTSFKGTSQINEGTESGIGAFRFMLEANKGRT 153
            ||:||||||||||||||||||:||||:|:|.:|..:|.|..:..:...:||||||||||:|||::
 Frog   156 RSAAKIALMNSVFNEHPSRRITDEFIEKSVCEALATFNGNREEADNPNTGIGAFRFMLESNKGKS 220

  Fly   154 MLEFQELMTVFQLLHWNGSLKAMRERHCSRQEVVAHYSNRSLDDEMRSQMALDWIAREHDNPGVI 218
            ||||||||||||||||||||||||||.||||||:||||:|:|||:||:|||:||:.||||.||.:
 Frog   221 MLEFQELMTVFQLLHWNGSLKAMRERQCSRQEVLAHYSHRALDDDMRNQMAMDWVNREHDTPGTL 285

  Fly   219 RRELVLAERELETFRMAGRELRFPKEKKDILMIAHNQLG 257
            .|||...||:|:..|:||:|||:.||||||||:|..|||
 Frog   286 ARELASTERQLDEARLAGKELRYHKEKKDILMLAAGQLG 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lftNP_001188775.1 LIX1 24..255 CDD:291615 173/230 (75%)
lix1lXP_031746876.1 LIX1 81..322 CDD:373420 173/230 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 368 1.000 Domainoid score I913
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 371 1.000 Inparanoid score I2081
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1026341at2759
OrthoFinder 1 1.000 - - FOG0007988
OrthoInspector 1 1.000 - - oto103079
Panther 1 1.100 - - LDO PTHR31139
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5506
SonicParanoid 1 1.000 - - X5938
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.190

Return to query results.
Submit another query.