DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ClpP and clpP

DIOPT Version :9

Sequence 1:NP_001260332.1 Gene:ClpP / 34402 FlyBaseID:FBgn0032229 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_051083.1 Gene:clpP / 844734 -ID:- Length:196 Species:Arabidopsis thaliana


Alignment Length:189 Identity:74/189 - (39%)
Similarity:120/189 - (63%) Gaps:3/189 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IPMV-VEQTGRGERAY-DIFSRLLKERIICLMGNITDDISSTVVAQLLFLQSENVNKPIHLYINS 92
            :|.| ....|.|:.:: ||::||.:||:..|...:..:||:.:::.:::|..|...|.::|:|||
plant     5 VPKVPFRSPGEGDTSWVDIYNRLYRERLFFLGQEVDTEISNQLISLMIYLSIEKDTKDLYLFINS 69

  Fly    93 PGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPGMRYSLPNARIMIHQP-SGGAQ 156
            |||.|.:|:|||||||:|:|.:.|.|:|.|.|:.|.:|..||...|.:.|:||:||||| |...:
plant    70 PGGWVISGMAIYDTMQFVRPDVQTICMGLAASIASFILVGGAITKRIAFPHARVMIHQPASSFYE 134

  Fly   157 GQATDILIHAEEIIKIKRQLTNIYVKHAKNTYEEMSGRMERDHFMTPEEAKVLGIIDHV 215
            .|..:.::.|||::|::..:|.:||:........:|..||||.||:..||:..||:|.|
plant   135 AQTGEFILEAEELLKLRETITRVYVQRTGKPIWVISEDMERDVFMSATEAQAHGIVDLV 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpPNP_001260332.1 clpP 28..222 CDD:178955 74/189 (39%)
clpPNP_051083.1 clpP 1..196 CDD:214340 74/189 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1274502at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10381
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.