DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ClpP and CLPP3

DIOPT Version :9

Sequence 1:NP_001260332.1 Gene:ClpP / 34402 FlyBaseID:FBgn0032229 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_564880.1 Gene:CLPP3 / 842985 AraportID:AT1G66670 Length:309 Species:Arabidopsis thaliana


Alignment Length:189 Identity:76/189 - (40%)
Similarity:118/189 - (62%) Gaps:4/189 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DIFSRLLKERIICLMGNITDDISSTVVAQLLFLQSENVNKPIHLYINSPGGVVTAGLAIYDTMQY 109
            |..:.||::||:.|...:.|..:..|::|||.|.:|:..:.|.|:||||||.:|||:.|||.|:.
plant    85 DTTNMLLRQRIVFLGSQVDDMTADLVISQLLLLDAEDSERDITLFINSPGGSITAGMGIYDAMKQ 149

  Fly   110 VKPPIATWCVGQACSMGSLLLAAGAPGMRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKR 174
            .|..::|.|:|.|.|||:.|||:|:.|.||.:||:::|||||.|.|.|:||::.|...|::..|.
plant   150 CKADVSTVCLGLAASMGAFLLASGSKGKRYCMPNSKVMIHQPLGTAGGKATEMSIRIREMMYHKI 214

  Fly   175 QLTNIYVKHAKNTYEEMSGRMERDHFMTPEEAKVLGIIDHVLEH-PPETVSETGPASDG 232
            :|..|:.:.......|:....:||:|:.|.|||..|:||.|::. .|..::   |..||
plant   215 KLNKIFSRITGKPESEIESDTDRDNFLNPWEAKEYGLIDAVIDDGKPGLIA---PIGDG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpPNP_001260332.1 clpP 28..222 CDD:178955 73/177 (41%)
CLPP3NP_564880.1 CLP_protease 85..257 CDD:395456 72/171 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0740
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1274502at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10381
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.