DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ClpP and CLP2

DIOPT Version :9

Sequence 1:NP_001260332.1 Gene:ClpP / 34402 FlyBaseID:FBgn0032229 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_563907.1 Gene:CLP2 / 837797 AraportID:AT1G12410 Length:279 Species:Arabidopsis thaliana


Alignment Length:229 Identity:81/229 - (35%)
Similarity:137/229 - (59%) Gaps:18/229 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SVQCG-GRANSVRNINLIPM---VVEQTGRGERAY---DIFSRLLKERIICLMGNITDDISSTVV 71
            |:|.| |:|:..| :.::|:   .|....|.|..:   ||::.|.:||:|.:..||.::.|:.::
plant    52 SLQSGTGKASRSR-VKMMPIGTPRVPYRNREEGTWQWVDIWNALYRERVIFIGQNIDEEFSNQIL 115

  Fly    72 AQLLFLQSENVNKPIHLYINSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPG 136
            |.:|:|.:.:.::.|::|:|.|||.:|..|||||||:.:|.|:.|.|||.|.::...|||||..|
plant   116 ATMLYLDTLDDSRRIYMYLNGPGGDLTPSLAIYDTMKSLKSPVGTHCVGLAYNLAGFLLAAGEKG 180

  Fly   137 MRYSLPNARIMIHQPSGGAQGQATDILIHAEEIIKIKRQLTNIYVKH----AKNTYEEMSGRMER 197
            .|:::|.:||.:..|:|.|:|||.||...|:|:.:|:..|.|...|:    |:..::::| |::|
plant   181 HRFAMPLSRIALQSPAGAARGQADDIQNEAKELSRIRDYLFNELAKNTGQPAERVFKDLS-RVKR 244

  Fly   198 DHFMTPEEAKVLGIIDHVLEHPPETVSETGPASD 231
               ...|||...|:||.::.  |..:.|..|..|
plant   245 ---FNAEEAIEYGLIDKIVR--PPRIKEDAPRQD 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpPNP_001260332.1 clpP 28..222 CDD:178955 72/203 (35%)
CLP2NP_563907.1 CLP_protease 86..262 CDD:366176 67/181 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0740
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1274502at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10381
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.