DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ClpP and CLPP6

DIOPT Version :9

Sequence 1:NP_001260332.1 Gene:ClpP / 34402 FlyBaseID:FBgn0032229 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001184966.1 Gene:CLPP6 / 837719 AraportID:AT1G11750 Length:289 Species:Arabidopsis thaliana


Alignment Length:192 Identity:70/192 - (36%)
Similarity:105/192 - (54%) Gaps:4/192 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NINLIPMVVEQTGRGERAYDIFSRLLKERIICLMGNITDDISSTVVAQLLFLQSENVNKPIHLYI 90
            |..::|.|:...|    ..|:.|.|.:.|||.:...|...::..|::||:.|.|.:....|.:|:
plant    99 NPPVMPSVMTPGG----PLDLSSVLFRNRIIFIGQPINAQVAQRVISQLVTLASIDDKSDILMYL 159

  Fly    91 NSPGGVVTAGLAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPGMRYSLPNARIMIHQPSGGA 155
            |.|||...:.|||||.|.::||.:.|...|.|.|.|:||||.|..||||::||.|:|||||..|.
plant   160 NCPGGSTYSVLAIYDCMSWIKPKVGTVAFGVAASQGALLLAGGEKGMRYAMPNTRVMIHQPQTGC 224

  Fly   156 QGQATDILIHAEEIIKIKRQLTNIYVKHAKNTYEEMSGRMERDHFMTPEEAKVLGIIDHVLE 217
            .|...|:.....|.|:.::::..:|........|::....|||.|::..||...|:||.:||
plant   225 GGHVEDVRRQVNEAIEARQKIDRMYAAFTGQPLEKVQQYTERDRFLSASEALEFGLIDGLLE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpPNP_001260332.1 clpP 28..222 CDD:178955 69/190 (36%)
CLPP6NP_001184966.1 CLP_protease 114..286 CDD:278971 64/171 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0740
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1274502at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10381
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.