DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and AT1G29090

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_564321.2 Gene:AT1G29090 / 839784 AraportID:AT1G29090 Length:355 Species:Arabidopsis thaliana


Alignment Length:347 Identity:113/347 - (32%)
Similarity:179/347 - (51%) Gaps:40/347 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IVTSNLSEGNSSSANCKSE------FEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQNYK 75
            |::.||....::|.....|      .:::....:|.|....::...:..|::|.|.||:.|   |
plant    22 ILSMNLKVSQATSRVTFHEPIVAEHHQQWMTRFSRVYSDELEKQMRFDVFKKNLKFIEKFN---K 83

  Fly    76 EGQTSFRLKPNIFADMSTDGY------LKGFLRLLKSNIEDSAD-----NMAEIVGSPLMANVPE 129
            :|..:::|..|.|||.:.:.:      |||...:..|...|...     |::::.|.       |
plant    84 KGDRTYKLGVNEFADWTREEFIATHTGLKGVNGIPSSEFVDEMIPSWNWNVSDVAGR-------E 141

  Fly   130 SLDWRSKGFITPPYNQLSCGSCYAFSIAESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGG 194
            :.|||.:|.:||...|..||.|:|||...::.|........::|||:||::||.....| ||.||
plant   142 TKDWRYEGAVTPVKYQGQCGCCWAFSSVAAVEGLTKIVGNNLVSLSEQQLLDCDRERDN-GCNGG 205

  Fly   195 SLRNTLSYLQSTGGIMRDQDYPYVARKGKCQFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPV 259
            .:.:..||:....||..:..|||.|.:|.|::....|.. :..:..:|..:|:|:..||:. .||
plant   206 IMSDAFSYIIKNRGIASEASYPYQAAEGTCRYNGKPSAW-IRGFQTVPSNNERALLEAVSK-QPV 268

  Fly   260 AISINASPKTFQLYSDGIYDDPLCSSASVNHAMVVIGFGKD-----YWILKNWWGQNWGENGYIR 319
            ::||:|....|..||.|:||:|.|.: :||||:..:|:|..     ||:.||.||:.||||||||
plant   269 SVSIDADGPGFMHYSGGVYDEPYCGT-NVNHAVTFVGYGTSPEGIKYWLAKNSWGETWGENGYIR 332

  Fly   320 IRKGV----NMCGIANYAAYAI 337
            ||:.|    .|||:|.||.|.:
plant   333 IRRDVAWPQGMCGVAQYAFYPV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 15/59 (25%)
Peptidase_C1A 128..336 CDD:239068 85/216 (39%)
AT1G29090NP_564321.2 PTZ00203 10..337 CDD:185513 105/328 (32%)
Inhibitor_I29 47..103 CDD:214853 15/58 (26%)
Peptidase_C1 141..354 CDD:278538 86/216 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.