DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and AT4G23520

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_567686.2 Gene:AT4G23520 / 828452 AraportID:AT4G23520 Length:356 Species:Arabidopsis thaliana


Alignment Length:327 Identity:104/327 - (31%)
Similarity:179/327 - (54%) Gaps:29/327 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NSSSANCKSEFEKFKNNNNRKYLRTYDEM-RSYKAFEENFKVIEEHNQNYKEGQTSFRLKPNIFA 89
            |.|:...:..|:.:.:.:.:.|.....|. |.::.|::|.:.|::||..    ..|::|....||
plant    37 NRSNEEVEFIFQMWMSKHGKTYTNALGEKERRFQNFKDNLRFIDQHNAK----NLSYQLGLTRFA 97

  Fly    90 DMSTDGY---LKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFITPPYNQLSCGSC 151
            |::...|   ..|..:..:.|::.|. ....:.|..|    |||:|||.:|.::...:|.:|.||
plant    98 DLTVQEYRDLFPGSPKPKQRNLKTSR-RYVPLAGDQL----PESVDWRQEGAVSEIKDQGTCNSC 157

  Fly   152 YAFSIAESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNT-LSYLQSTGGIMRDQDY 215
            :|||...::.|.....||:::|||:|::|||::.  |.||.|..|.:| ..:|.:..|:..::||
plant   158 WAFSTVAAVEGLNKIVTGELISLSEQELVDCNLV--NNGCYGSGLMDTAFQFLINNNGLDSEKDY 220

  Fly   216 PYVARKGKCQFVPDLS--VVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIY 278
            ||...:|.|......|  |:.:.|:..:|..||.::|.||.| .||::.::...:.|.||...||
plant   221 PYQGTQGSCNRKQSTSNKVITIDSYEDVPANDEISLQKAVAH-QPVSVGVDKKSQEFMLYRSCIY 284

  Fly   279 DDPLCSSASVNHAMVVIGF----GKDYWILKNWWGQNWGENGYIRIRKGV----NMCGIANYAAY 335
            :.| |.: :::||:|::|:    |:||||::|.||..||:.|||:|.:..    .:||||..|:|
plant   285 NGP-CGT-NLDHALVIVGYGSENGQDYWIVRNSWGTTWGDAGYIKIARNFEDPKGLCGIAMLASY 347

  Fly   336 AI 337
            .|
plant   348 PI 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 14/60 (23%)
Peptidase_C1A 128..336 CDD:239068 80/218 (37%)
AT4G23520NP_567686.2 Inhibitor_I29 47..103 CDD:214853 14/59 (24%)
Peptidase_C1 133..349 CDD:278538 82/224 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.