DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and AT2G27420

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_565649.1 Gene:AT2G27420 / 817287 AraportID:AT2G27420 Length:348 Species:Arabidopsis thaliana


Alignment Length:335 Identity:95/335 - (28%)
Similarity:175/335 - (52%) Gaps:29/335 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SEGNSSSANCKSEFEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQNYKEGQTSFRLKPNI 87
            |.|:...|:...:.|::....||.|....::...:..|::|.:.::..|.|.|   .::::..|.
plant    22 SRGSLFEASAIEKHEQWMARFNRVYSDETEKRNRFNIFKKNLEFVQNFNMNNK---ITYKVDINE 83

  Fly    88 FADMSTDGYLKGFLRLLK-------SNIEDSADNMAEIVGSPLMANVPESLDWRSKGFITPPYNQ 145
            |:|::.:.:......|:.       |.:....:.:....|:  :::..||:|||.:|.:||...|
plant    84 FSDLTDEEFRATHTGLVVPEAITRISTLSSGKNTVPFRYGN--VSDNGESMDWRQEGAVTPVKYQ 146

  Fly   146 LSCGSCYAFSIAESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIM 210
            ..||.|:|||...::.|......|:::|||:||::||...: ||||.||.:.....|:....||.
plant   147 GRCGGCWAFSAVAAVEGITKITKGELVSLSEQQLLDCDRDY-NQGCRGGIMSKAFEYIIKNQGIT 210

  Fly   211 RDQDYPYVARKGKCQFVPDLS----VVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQ 271
            .:.:|||...:..|.....||    ...::.:..:|:.:|:|:..||:. .||::.|..:...|:
plant   211 TEDNYPYQESQQTCSSSTTLSSSFRAATISGYETVPMNNEEALLQAVSQ-QPVSVGIEGTGAAFR 274

  Fly   272 LYSDGIYDDPLCSSASVNHAMVVIGFGKD-----YWILKNWWGQNWGENGYIRIRKGVN----MC 327
            .||.|:::.. |.: .::||:.::|:|..     ||::||.||:.||||||:||::.|:    ||
plant   275 HYSGGVFNGE-CGT-DLHHAVTIVGYGMSEEGTKYWVVKNSWGETWGENGYMRIKRDVDAPQGMC 337

  Fly   328 GIANYAAYAI 337
            |:|..|.|.:
plant   338 GLAILAFYPL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 12/59 (20%)
Peptidase_C1A 128..336 CDD:239068 76/220 (35%)
AT2G27420NP_565649.1 Inhibitor_I29 35..91 CDD:214853 12/58 (21%)
Peptidase_C1 130..347 CDD:278538 77/220 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.