DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and Ctsb

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_072119.2 Gene:Ctsb / 64529 RGDID:621509 Length:339 Species:Rattus norvegicus


Alignment Length:373 Identity:87/373 - (23%)
Similarity:143/373 - (38%) Gaps:99/373 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WKLIFFGCLCGLNCQIVTSNLSEGNSSSANCKSEFEKFKNNNNRKYLRTYDEMRSYKAFEENFKV 66
            |.||...||..|              :||:.|..|....           |:|.:|         
  Rat     3 WSLIPLSCLLAL--------------TSAHDKPSFHPLS-----------DDMINY--------- 33

  Fly    67 IEEHNQNYKEGQTSFRLKPNIFADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESL 131
            |.:.|..::.|:..:.:      |:|   |||   :|..:.:  ....:.|.||.....|:|||.
  Rat    34 INKQNTTWQAGRNFYNV------DIS---YLK---KLCGTVL--GGPKLPERVGFSEDINLPESF 84

  Fly   132 DWRSKGFITPPYNQL----SCGSCYAFSIAESIMGQVFKRT-GKI-LSLSKQQIVDCSVSHGNQG 190
            |.|.:....|...|:    |||||:||...|::..::...| |:: :.:|.:.::.|.......|
  Rat    85 DAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDG 149

  Fly   191 CVGGSLRNTLSYLQS----TGGIMRDQ--DYPYV---------ARKGKCQFVPDLSVVN------ 234
            |.||......::...    :||:....  ..||.         ..:..|....|....|      
  Rat   150 CNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGSRPPCTGEGDTPKCNKMCEAG 214

  Fly   235 ------------VTSWAILPVRDEQAIQAAVTHIGPV--AISINASPKTFQLYSDGIYDDPLCSS 285
                        .||:::..  .|:.|.|.:...|||  |.::.:.   |..|..|:|... ...
  Rat   215 YSTSYKEDKHYGYTSYSVSD--SEKEIMAEIYKNGPVEGAFTVFSD---FLTYKSGVYKHE-AGD 273

  Fly   286 ASVNHAMVVIGFGKD----YWILKNWWGQNWGENGYIRIRKGVNMCGI 329
            ....||:.::|:|.:    ||::.|.|..:||:||:.:|.:|.|.|||
  Rat   274 VMGGHAIRILGWGIENGVPYWLVANSWNVDWGDNGFFKILRGENHCGI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 9/59 (15%)
Peptidase_C1A 128..336 CDD:239068 61/247 (25%)
CtsbNP_072119.2 Propeptide_C1 26..65 CDD:285358 12/72 (17%)
Peptidase_C1A_CathepsinB 81..328 CDD:239111 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.