DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and Tpbpa

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_742070.1 Gene:Tpbpa / 64509 RGDID:621454 Length:124 Species:Rattus norvegicus


Alignment Length:104 Identity:18/104 - (17%)
Similarity:45/104 - (43%) Gaps:14/104 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YDEMRSYK--------AFEENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTDGYLKGFLRLLKSN 107
            |.|::..|        .::|..|.::.:|....:.:....::.:..::::.:.::| .:..:..:
  Rat    26 YAELQEQKGKEGFRKAVWDEFMKTVKLYNSKSDQEEEELDIEMSALSELTDEDFMK-IMTSISHS 89

  Fly   108 IEDSADNMAEIVGSPLMANVPESLDWRSKGFITPPYNQL 146
            :....:|.|:.:|     :|||..|....|...|...||
  Rat    90 MSGEDENQAQSLG-----DVPEFEDLVESGDEIPIQEQL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 6/52 (12%)
Peptidase_C1A 128..336 CDD:239068 7/19 (37%)
TpbpaNP_742070.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.