DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and Ctsz

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_071720.1 Gene:Ctsz / 64138 MGIID:1891190 Length:306 Species:Mus musculus


Alignment Length:234 Identity:70/234 - (29%)
Similarity:109/234 - (46%) Gaps:49/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SPLMANVPESLDWRSKGFIT----------PPYNQLSCGSCYAFSIAESIMGQV-FKRTG---KI 171
            ||  |::|::.|||:...:.          |.|    ||||:|.....::..:: .||.|   .|
Mouse    60 SP--ADLPKNWDWRNVNGVNYASVTRNQHIPQY----CGSCWAHGSTSAMADRINIKRKGAWPSI 118

  Fly   172 LSLSKQQIVDCSVSHGNQG-CVGGSLRNTLSYLQSTG--------GIMRDQDYPYVARKGKC-QF 226
            | ||.|.::||    ||.| |.||:......|....|        ...:|||.....:.|.| :|
Mouse   119 L-LSVQNVIDC----GNAGSCEGGNDLPVWEYAHKHGIPDETCNNYQAKDQDCDKFNQCGTCTEF 178

  Fly   227 VPDLSVVNVTSWAI-----LPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSA 286
            ....::.|.|.|.:     |..|::  :.|.:...||::..|.|: :....|:.|||.:.. ..|
Mouse   179 KECHTIQNYTLWRVGDYGSLSGREK--MMAEIYANGPISCGIMAT-EMMSNYTGGIYAEHQ-DQA 239

  Fly   287 SVNHAMVVIGFGK-----DYWILKNWWGQNWGENGYIRI 320
            .:||.:.|.|:|.     :|||::|.||:.|||.|::||
Mouse   240 VINHIISVAGWGVSNDGIEYWIVRNSWGEPWGEKGWMRI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458
Peptidase_C1A 128..336 CDD:239068 67/227 (30%)
CtszNP_071720.1 Peptidase_C1A_CathepsinX 64..305 CDD:239149 67/228 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.