DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsL4 and Ctsr

DIOPT Version :10

Sequence 1:NP_609387.1 Gene:CtsL4 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_064680.1 Gene:Ctsr / 56835 MGIID:1861723 Length:334 Species:Mus musculus


Alignment Length:31 Identity:11/31 - (35%)
Similarity:17/31 - (54%) Gaps:6/31 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KIVLAIDIAICLTLLGVWLAIC------HGI 148
            |||...|:::..|.||.::|.|      ||:
Mouse   286 KIVEMEDVSLLFTSLGKYIACCVIGHAIHGL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsL4NP_609387.1 Inhibitor_I29 36..96 CDD:462410
Peptidase_C1A 128..336 CDD:239068 8/27 (30%)
CtsrNP_064680.1 Inhibitor_I29 29..87 CDD:214853
Peptidase_C1A 116..332 CDD:239068 11/31 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.