DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and ctsf

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001071036.1 Gene:ctsf / 565588 ZFINID:ZDB-GENE-030131-9831 Length:473 Species:Danio rerio


Alignment Length:314 Identity:106/314 - (33%)
Similarity:164/314 - (52%) Gaps:30/314 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQNYKEGQTSFRLKPNI-------FADMSTDGY 96
            |||     ::.||:  |:|.:.||..|.:....||.|..||...|:...       |:|::.|.:
Zfish   175 FKN-----FMITYN--RTYSSQEEAEKRLRIFQQNMKTAQTLQSLEQGSAEYGITKFSDLTEDEF 232

  Fly    97 LKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFITPPYNQLSCGSCYAFSIAESIM 161
            ...:|..:.|......:....|   |..|..|::.|||..|.::|..||..||||:|||:..:|.
Zfish   233 RMMYLNPMLSQWSLKKEMKPAI---PASAPAPDTWDWRDHGAVSPVKNQGMCGSCWAFSVTGNIE 294

  Fly   162 GQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKGKCQF 226
            ||.||:||::||||:|::|||...  :|.|.||...|....:::.||:..:.||.|...|..|.|
Zfish   295 GQWFKKTGQLLSLSEQELVDCDKL--DQACGGGLPSNAYEAIENLGGLETETDYSYTGHKQSCDF 357

  Fly   227 VPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPL---CSSASV 288
            ........:.|...|| :||:.|.|.:...|||:.::||.  ..|.|..|: ..||   |:...:
Zfish   358 STGKVAAYINSSVELP-KDEKEIAAFLAENGPVSAALNAF--AMQFYRKGV-SHPLKIFCNPWMI 418

  Fly   289 NHAMVVIGFGK----DYWILKNWWGQNWGENGYIRIRKGVNMCGIANYAAYAIV 338
            :||::::|||:    .:|.:||.||:::||.||..:.:|..:|||....:.|||
Zfish   419 DHAVLLVGFGQRNGVPFWAIKNSWGEDYGEQGYYYLYRGSGLCGIHKMCSSAIV 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 19/63 (30%)
Peptidase_C1A 128..336 CDD:239068 79/214 (37%)
ctsfNP_001071036.1 CY 34..144 CDD:214484
PTZ00203 143..472 CDD:185513 104/312 (33%)
Inhibitor_I29 175..231 CDD:214853 18/62 (29%)
Peptidase_C1 262..471 CDD:278538 78/214 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.