DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsL4 and Ctsf

DIOPT Version :10

Sequence 1:NP_609387.1 Gene:CtsL4 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_063914.1 Gene:Ctsf / 56464 MGIID:1861434 Length:462 Species:Mus musculus


Alignment Length:37 Identity:11/37 - (29%)
Similarity:14/37 - (37%) Gaps:18/37 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LAIDIA-----ICLTLLGV-----------WL--AIC 145
            |.:.||     :|..||.|           ||  |:|
Mouse   267 LTLSIAGIFKEVCTLLLAVEFLGDKMSTVNWLGFAVC 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsL4NP_609387.1 Inhibitor_I29 36..96 CDD:462410
Peptidase_C1A 128..336 CDD:239068 10/36 (28%)
CtsfNP_063914.1 Inhibitor_I29 165..221 CDD:214853
Peptidase_C1 249..460 CDD:425470 11/37 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.