DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and zgc:110239

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001017633.2 Gene:zgc:110239 / 550326 ZFINID:ZDB-GENE-050417-107 Length:546 Species:Danio rerio


Alignment Length:333 Identity:105/333 - (31%)
Similarity:163/333 - (48%) Gaps:33/333 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IVTSNLSEGNSSSANCKSEFEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQNYKEGQT-- 79
            :.||.:|..:....:.|.:|.           |.||....::..|.||    .||..|.....  
Zfish   231 VETSPVSHAHRMFGHYKEKFN-----------RQYDNEMEHEEREHNF----VHNIRYVHSMNRA 280

  Fly    80 --SFRLKPNIFADMSTD--GYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFIT 140
              ||.|..|..||.|..  ..::|..|..|  :...|......:.|   ...|.|:|||..|.:|
Zfish   281 GLSFSLSVNHLADRSQKELSMMRGCQRTHK--VHRKAQPFPSEIRS---IATPNSVDWRLYGAVT 340

  Fly   141 PPYNQLSCGSCYAFSIAESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQS 205
            |..:|..||||::|:...::.|.:|.:||::.|||:|.:|||:...||.||.||.......::..
Zfish   341 PVKDQAVCGSCWSFATTGTLEGALFLKTGQLTSLSQQMLVDCTWGFGNNGCDGGEEWRAFEWIMK 405

  Fly   206 TGGIMRDQDY-PYVARKGKCQFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKT 269
            .|||...:.| .|:...|.|.:.....|..:|.:..:...|..|::||:...||||:||:|:.::
Zfish   406 HGGISTAESYGAYMGMNGLCHYDKTSMVAQLTGYTNVTSGDILALKAAIFKFGPVAVSIDAAHRS 470

  Fly   270 FQLYSDGIYDDPLCSSA--SVNHAMVVIGFG----KDYWILKNWWGQNWGENGYIRIRKGVNMCG 328
            |..||:|:|.:|.|.:.  .::||::.:|:|    :.||::||.|...||.:|||.:....|.||
Zfish   471 FAFYSNGVYYEPECKNGINDLDHAVLAVGYGIMNNESYWLVKNSWSSYWGNDGYILMSMKDNNCG 535

  Fly   329 IANYAAYA 336
            :|..|.||
Zfish   536 VATDAIYA 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 17/65 (26%)
Peptidase_C1A 128..336 CDD:239068 77/214 (36%)
zgc:110239NP_001017633.2 Inhibitor_I29 243..298 CDD:214853 18/69 (26%)
Peptidase_C1A 328..543 CDD:239068 77/214 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.