DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and ctsl.1

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001002368.1 Gene:ctsl.1 / 436641 ZFINID:ZDB-GENE-040718-61 Length:334 Species:Danio rerio


Alignment Length:337 Identity:125/337 - (37%)
Similarity:193/337 - (57%) Gaps:23/337 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IVTSNLSEGNSSSANCKS-EFEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQNYKEGQTS 80
            :..:.|:..:::|.:.:. ||..:|....:.|....:|......:..|.|::..||....:|..|
Zfish     6 VAAAFLAVASAASLSLEDMEFHAWKLKFGKSYRSAEEESHRQLTWLTNRKLVLVHNMMADQGLKS 70

  Fly    81 FRLKPNIFADMSTDGY----LKGFLRLLKSNIEDSADNMAEIVGSPLM-----ANVPESLDWRSK 136
            :||....|||||.:.|    .:|.|        .|.:|.....||...     |.||:::|||.|
Zfish    71 YRLGMTYFADMSNEEYRQLVFRGCL--------GSMNNTKARGGSTFFRLRKAAVVPDTVDWRDK 127

  Fly   137 GFITPPYNQLSCGSCYAFSIAESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLS 201
            |::|...:|..||||:|||...|:.||.|::|||::|||:||:||||.|:||.||.||.:.....
Zfish   128 GYVTDIKDQKQCGSCWAFSATGSLEGQTFRKTGKLVSLSEQQLVDCSGSYGNYGCDGGLMDQAFQ 192

  Fly   202 YLQSTGGIMRDQDYPYVARKGKCQFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINAS 266
            |:::..|:..:..|||.|:.|:|:|.|.....:.|.:..:...||.|:|.||..|||::::|:|.
Zfish   193 YIEANKGLDTEDSYPYEAQDGECRFNPSTVGASCTGYVDIASGDESALQEAVATIGPISVAIDAG 257

  Fly   267 PKTFQLYSDGIYDDPLCSSASVNHAMVVIGFGK----DYWILKNWWGQNWGENGYIRI-RKGVNM 326
            ..:|||||.|:|::|.|||:.::|.::.:|:|.    ||||:||.||.:||..|||.: |...|.
Zfish   258 HSSFQLYSSGVYNEPDCSSSELDHGVLAVGYGSSNGDDYWIVKNSWGLDWGVQGYILMSRNKSNQ 322

  Fly   327 CGIANYAAYAIV 338
            ||||..|:|.:|
Zfish   323 CGIATAASYPLV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 17/59 (29%)
Peptidase_C1A 128..336 CDD:239068 94/212 (44%)
ctsl.1NP_001002368.1 Inhibitor_I29 26..86 CDD:285458 17/59 (29%)
Peptidase_C1 118..333 CDD:278538 96/214 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.