DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and CG11459

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster


Alignment Length:313 Identity:103/313 - (32%)
Similarity:174/313 - (55%) Gaps:18/313 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SEFEKFKNNNNRKYLRTYDEMRSYKA-FEENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTD-GY 96
            :|::::|...|::| |..|  :.::| :|:....:|.|||.|.:|:.:|::..|.|:|  || ..
  Fly    28 TEWDQYKAKYNKQY-RNRD--KYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD--TDQRI 87

  Fly    97 LKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFITPPYNQ-LSCGSCYAFSIAESI 160
            |..:...:.:.:|.|.:.:.|.|.......:.|.:|||..|:|:|..:| ..|.||:|||.:..:
  Fly    88 LFNYRSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVL 152

  Fly   161 MGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKGKCQ 225
            ...:.|:.|.::.||.:.:||| |.:.|.||.||.:....:|.:. .||...:.|||....|:|.
  Fly   153 EAHMAKKYGNLVPLSPKHLVDC-VPYPNNGCSGGWVSVAFNYTRD-HGIATKESYPYEPVSGECL 215

  Fly   226 FVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSS--ASV 288
            :..|.|...::.:..|...||:.:...|.:|||||:||:...:.|..||.|:...|.|.|  ..:
  Fly   216 WKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDL 280

  Fly   289 NHAMVVIGFGK-----DYWILKNWWGQNWGENGYIRI-RKGVNMCGIANYAAY 335
            .|:::::|||.     ||||:||.:|.:|||:||::: |...||||:|:...|
  Fly   281 THSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNANNMCGVASLPQY 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 19/61 (31%)
Peptidase_C1A 128..336 CDD:239068 78/217 (36%)
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 18/59 (31%)
Peptidase_C1A 120..334 CDD:239068 78/216 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449288
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.