DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and ctsc

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_999887.1 Gene:ctsc / 368704 ZFINID:ZDB-GENE-030619-9 Length:455 Species:Danio rerio


Alignment Length:342 Identity:86/342 - (25%)
Similarity:136/342 - (39%) Gaps:93/342 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KFKNNNNRKYLRTYDEMRSYK--------AFEENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTD 94
            |....||..::   ||:.|.:        :|.|...:   |....:.|..:.|:...:       
Zfish   158 KLPYTNNMMFV---DEINSVQKSWTATAYSFHETLSI---HEMLRRSGGPASRIPRRV------- 209

  Fly    95 GYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRS---KGFITPPYNQLSCGSCYAFSI 156
                       ..:..:||:.|       .:.:|:..|||:   ..|::|..||..|||||:|:.
Zfish   210 -----------RPVTVAADSKA-------ASGLPQHWDWRNVNGVNFVSPVRNQAQCGSCYSFAT 256

  Fly   157 AESIMGQVFKRTGKILS--LSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVA 219
            ...:..:|..:|.....  .|.||:|.|  |..:|||.||.......|:|.. ||:.:..:||..
Zfish   257 MGMLEARVRIQTNNTQQPVFSPQQVVSC--SQYSQGCDGGFPYLIGKYIQDF-GIVEEDCFPYTG 318

  Fly   220 RKGKCQFVPDLSVVNVTSWAILPVR-------------------DEQAIQAAVTHIGPVAISINA 265
            ....|.               ||.:                   .|.|:...:...||:.:::..
Zfish   319 SDSPCN---------------LPAKCTKYYASDYHYVGGFYGGCSESAMMLELVKNGPMGVALEV 368

  Fly   266 SPKTFQLYSDGIYDDPLCSSAS-----VNHAMVVIGF------GKDYWILKNWWGQNWGENGYIR 319
            .| .|..|.:|||.......|:     .|||::::|:      |:.|||:||.||..|||||:.|
Zfish   369 YP-DFMNYKEGIYHHTGLRDANNPFELTNHAVLLVGYGQCHKTGEKYWIVKNSWGSGWGENGFFR 432

  Fly   320 IRKGVNMCGIANYAAYA 336
            ||:|.:.|.|.:.|..|
Zfish   433 IRRGTDECAIESIAVAA 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 11/65 (17%)
Peptidase_C1A 128..336 CDD:239068 71/242 (29%)
ctscNP_999887.1 CathepsinC_exc 20..132 CDD:285926
Peptidase_C1A_CathepsinC 224..452 CDD:239112 72/245 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.