DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and CG6347

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster


Alignment Length:323 Identity:111/323 - (34%)
Similarity:174/323 - (53%) Gaps:28/323 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FEKFKNNNNRKYLRTYDEMRSYK--AFEENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTDGYLK 98
            |:.|.....:.|   .||.|.|:  .|.....:|...|:|...|.:.|||..|..|||:.    |
  Fly    38 FDDFLRQTGKVY---SDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTR----K 95

  Fly    99 GFLRLLKSNIEDSADNMAE------IVGSPLMANVPESLDWRSKGFITPP-YNQLSCGSCYAFSI 156
            ....||.|.|.:..:....      ...:|..||:||..|||.||.:||| :..:.||:|::|:.
  Fly    96 EIATLLGSKISEFGERYTNGHINFVTARNPASANLPEMFDWREKGGVTPPGFQGVGCGACWSFAT 160

  Fly   157 AESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARK 221
            ..::.|.:|:|||.:.|||:|.:|||:..:||.||.||.......|::..|..:.:: |||...:
  Fly   161 TGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYGFEYIRDHGVTLANK-YPYTQTE 224

  Fly   222 GKCQ------FVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDD 280
            .:|:      ..|..|:|.:..:|.:...||:.::..:..:||:|.|:||...:|:.||.|||:|
  Fly   225 MQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYED 289

  Fly   281 PLCSSASVNHAMVVIGF----GKDYWILKNWWGQNWGENGYIRI-RKGVNMCGIANYAAYAIV 338
            ..|:...:||::.|:|:    |:||||:||.:.|||||.|::|| |.....||||:..:|.|:
  Fly   290 EECNQGELNHSVTVVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECSYPIL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 19/61 (31%)
Peptidase_C1A 128..336 CDD:239068 82/219 (37%)
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 20/65 (31%)
Peptidase_C1A 131..350 CDD:239068 82/219 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449287
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.