DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and CtsB1

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster


Alignment Length:330 Identity:74/330 - (22%)
Similarity:126/330 - (38%) Gaps:87/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTDGYLKGFLRLLKSNIEDSADNMA-----EIVG 120
            :|..:|:....:.:..|:.        |....|:|:::   ||:  .:...|...|     |::|
  Fly    26 DEFIEVVRSKAKTWTVGRN--------FDASVTEGHIR---RLM--GVHPDAHKFALPDKREVLG 77

  Fly   121 SPLMANV---PESLDWRSKGFITPPYNQL----SCGSCYAFSIAESIMGQV-FKRTGKI-LSLSK 176
            ...:.:|   ||..|.|.:....|...::    |||||:||...|::..:| ....||: ...|.
  Fly    78 DLYVNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSA 142

  Fly   177 QQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKG-------KCQF-------- 226
            ..:|.|..:.| .||.||......||....|.:   ...||.:.:|       .|:.        
  Fly   143 DDLVSCCHTCG-FGCNGGFPGAAWSYWTRKGIV---SGGPYGSNQGCRPYEISPCEHHVNGTRPP 203

  Fly   227 ------VPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQ-------------- 271
                  .|..|.|..:.:.:...:|:        |.|..:.|:..:.:..|              
  Fly   204 CAHGGRTPKCSHVCQSGYTVDYAKDK--------HFGSKSYSVRRNVREIQEEIMTNGPVEGAFT 260

  Fly   272 ------LYSDGIYDDPLCSSASVNHAMVVIGFGK------DYWILKNWWGQNWGENGYIRIRKGV 324
                  ||.||:|......... .||:.::|:|.      .||::.|.|..:||::|:.||.:|.
  Fly   261 VYEDLILYKDGVYQHEHGKELG-GHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQ 324

  Fly   325 NMCGI 329
            :.|||
  Fly   325 DHCGI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 5/34 (15%)
Peptidase_C1A 128..336 CDD:239068 61/255 (24%)
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 8/50 (16%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 61/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.