DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and si:dkey-239j18.2

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001274132.1 Gene:si:dkey-239j18.2 / 321853 ZFINID:ZDB-GENE-121214-52 Length:335 Species:Danio rerio


Alignment Length:316 Identity:108/316 - (34%)
Similarity:182/316 - (57%) Gaps:21/316 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTDGY---L 97
            :..:|:.:.:.|.... |:.....:|||.:.||:||..|..|..:|::..|.|.||:.:.:   :
Zfish    28 WNSWKSQHGKSYHEDV-EVGRRMIWEENLRKIEQHNFEYSLGNHTFKMGMNQFGDMTNEEFRQAM 91

  Fly    98 KGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFITPPYNQLSCGSCYAFSIAESIMG 162
            .|:..      :.:..:...:...|.....|:.:|||.:|::||..:|..||||::||...::.|
Zfish    92 NGYKH------DPNRTSQGPLFMEPKFFAAPQQVDWRQRGYVTPVKDQKQCGSCWSFSSTGALEG 150

  Fly   163 QVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKG-KCQF 226
            |:|::|||::|:|:|.:||||..||||||.||.:.....|::...|:..:|.|||:||.. .|::
Zfish   151 QLFRKTGKLISMSEQNLVDCSRPHGNQGCNGGLMDQAFQYVKENKGLDSEQSYPYLARDDLPCRY 215

  Fly   227 VPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSASVNHA 291
            .|..:|..:|.:..:|..:|.|:..||..:|||:::|:||.::.|.|..|||.:..|:| .::||
Zfish   216 DPRFNVAKITGFVDIPKGNELALMNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACTS-QLDHA 279

  Fly   292 MVVIGF--------GKDYWILKNWWGQNWGENGYIRIRKGV-NMCGIANYAAYAIV 338
            ::|:|:        |..|||:||.|...||:.|||.:.|.. |.||||..|:|.::
Zfish   280 VLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCGIATMASYPLM 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 17/59 (29%)
Peptidase_C1A 128..336 CDD:239068 88/217 (41%)
si:dkey-239j18.2NP_001274132.1 Inhibitor_I29 28..86 CDD:214853 17/58 (29%)
Peptidase_C1 115..334 CDD:278538 89/219 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.