DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and Cts8l1

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_225128.9 Gene:Cts8l1 / 290972 RGDID:1309469 Length:333 Species:Rattus norvegicus


Alignment Length:326 Identity:118/326 - (36%)
Similarity:193/326 - (59%) Gaps:32/326 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SSSANCKSEFEKFKNNNNRKYLRTY---DEMRSYKAFEENFKVIEEHNQNYKEGQTSFRLKPNIF 88
            ||..:..||::::|    .||.:.|   :|.:....:|||.||:::||..|.:|:.:|.:|.|.|
  Rat    20 SSDPSLDSEWQEWK----IKYDKNYSLEEEGQRRAVWEENMKVVKQHNIEYDQGKNNFTMKVNAF 80

  Fly    89 ADMSTDGYLK-----GFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFITPPYNQLSC 148
            .||:.:.:.|     ..||..|.          : :.|.....:|:.:|||.:|::|...||..|
  Rat    81 GDMTGEEFRKMMIDIPVLRFRKK----------KXIQSHTGGYLPKFVDWRRRGYVTSVKNQGRC 135

  Fly   149 GSCYAFSIAESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQ 213
            .||:|||:|.:|.||:|::||:::|||.|.:||||...||:||:.|....|..|:.:.||:..:.
  Rat   136 NSCWAFSVAGAIEGQMFRKTGRLVSLSAQNLVDCSRPEGNRGCISGHTFYTFKYVWNNGGLEAES 200

  Fly   214 DYPYVARKGKCQFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIY 278
            .|||..|:|.|:::|:.|...:..::|:. ..|:|:..||..|||:::.|:||.::|..||.|||
  Rat   201 TYPYEGREGHCRYLPERSAARIKGFSIIS-STEEALMNAVATIGPISVGIDASHESFTFYSGGIY 264

  Fly   279 DDPLCSSASVNHAMVVIGF--------GKDYWILKNWWGQNWGENGYIRIRKGVNM-CGIANYAA 334
            .:|.|.:.:||||::::|:        |:.||::||..|..||.|||:::.:|.|. ||||..|.
  Rat   265 YEPKCRNKTVNHAVLLVGYGYEGRESDGRKYWLIKNSHGVGWGMNGYMKLARGWNKHCGIATCAF 329

  Fly   335 Y 335
            |
  Rat   330 Y 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 20/62 (32%)
Peptidase_C1A 128..336 CDD:239068 89/217 (41%)
Cts8l1XP_225128.9 Inhibitor_I29 29..88 CDD:400519 20/62 (32%)
Peptidase_C1A 115..331 CDD:239068 89/217 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.