DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and Ctsz

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_899159.1 Gene:Ctsz / 252929 RGDID:708479 Length:306 Species:Rattus norvegicus


Alignment Length:233 Identity:68/233 - (29%)
Similarity:109/233 - (46%) Gaps:47/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SPLMANVPESLDWRSKGFIT----------PPYNQLSCGSCYAFSIAESIMGQV-FKRTGKILS- 173
            ||  |::|::.|||:...:.          |.|    ||||:|.....::..:: .||.|...| 
  Rat    60 SP--ADLPKNWDWRNVNGVNYASVTRNQHIPQY----CGSCWAHGSTSALADRINIKRKGAWPST 118

  Fly   174 -LSKQQIVDCSVSHGNQG-CVGGSLRNTLSYLQSTG--------GIMRDQDYPYVARKGKC-QFV 227
             ||.|.::||    ||.| |.||:......|....|        ...:||:.....:.|.| :|.
  Rat   119 LLSVQNVIDC----GNAGSCEGGNDLPVWEYAHKHGIPDETCNNYQAKDQECDKFNQCGTCTEFK 179

  Fly   228 PDLSVVNVTSWAI-----LPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSAS 287
            ...::.|.|.|.:     |..|::  :.|.:...||::..|.|:.: ...|:.|||.: ..:.|.
  Rat   180 ECHTIQNYTLWRVGDYGSLSGREK--MMAEIYANGPISCGIMATER-MSNYTGGIYTE-YQNQAI 240

  Fly   288 VNHAMVVIGFGK-----DYWILKNWWGQNWGENGYIRI 320
            :||.:.|.|:|.     :|||::|.||:.|||.|::||
  Rat   241 INHIISVAGWGVSNDGIEYWIVRNSWGEPWGERGWMRI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458
Peptidase_C1A 128..336 CDD:239068 65/226 (29%)
CtszNP_899159.1 Peptidase_C1A_CathepsinX 64..305 CDD:239149 65/227 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.