DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and Ctso

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_808330.1 Gene:Ctso / 229445 MGIID:2139628 Length:312 Species:Mus musculus


Alignment Length:224 Identity:79/224 - (35%)
Similarity:121/224 - (54%) Gaps:20/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 NVPESLDWRSKGFITPPYNQLSCGSCYAFSIAESI-MGQVFKRTGKILS-LSKQQIVDCSVSHGN 188
            ::|...|||.|..:.|..||..||.|:|||:..:| ..:..:  ||.|. ||.||::|||.:  |
Mouse    98 SLPLRFDWRDKHVVNPVRNQEMCGGCWAFSVVSAIESARAIQ--GKSLDYLSVQQVIDCSFN--N 158

  Fly   189 QGCVGGSLRNTLSYLQSTG-GIMRDQDYPYVARKGKCQFVPD----LSVVNVTSWAILPVRDEQA 248
            .||:|||....|.:|..|. .::.|..||:.|..|:|:..|.    :||.:.:::......||.|
Mouse   159 SGCLGGSPLCALRWLNETQLKLVADSQYPFKAVNGQCRHFPQSQAGVSVKDFSAYNFRGQEDEMA 223

  Fly   249 IQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSASVNHAMVVIGFGK----DYWILKNWWG 309
              .|:...||:.:.::|  .::|.|..||.... |||...|||:::.||.:    .||:::|.||
Mouse   224 --RALLSFGPLVVIVDA--MSWQDYLGGIIQHH-CSSGEANHAVLITGFDRTGNTPYWMVRNSWG 283

  Fly   310 QNWGENGYIRIRKGVNMCGIANYAAYAIV 338
            .:||..||..::.|.|:||||:..|...|
Mouse   284 SSWGVEGYAHVKMGGNVCGIADSVAAVFV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458
Peptidase_C1A 128..336 CDD:239068 78/218 (36%)
CtsoNP_808330.1 Peptidase_C1A 100..305 CDD:239068 76/213 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.