DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and cpr-2

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_507186.3 Gene:cpr-2 / 185355 WormBaseID:WBGene00000782 Length:326 Species:Caenorhabditis elegans


Alignment Length:224 Identity:68/224 - (30%)
Similarity:99/224 - (44%) Gaps:51/224 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 QLSCGSCYAFSIAESIMGQVFKRTGKILSLSKQQIVD-------CSVSHGNQGCVGGSLRNTLSY 202
            |.:||||:|||.||.|.    .||....:.::|.|:.       |.:|.| :||.||.......:
 Worm   105 QSNCGSCWAFSTAEVIS----DRTCIASNGTQQPIISPTDLLTCCGMSCG-EGCDGGFPYRAFQW 164

  Fly   203 LQSTGGIMRDQDY------PYVAR---------------KGKCQ------FVPDLSVVNVTSWAI 240
             .:..|::...||      ||..|               :..||      :..|.:..|    :.
 Worm   165 -WARRGVVTGGDYLGTGCKPYPIRPCNSDNCVNLQTPPCRLSCQPGYRTTYTNDKNYGN----SA 224

  Fly   241 LPV-RDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSASVNHAMVVIGFGKD---- 300
            .|| |...||||.:.:.|||..:.... :.|:.|..|||.. :...:...||:.:||:|.:    
 Worm   225 YPVPRTVAAIQADIYYNGPVVAAFIVY-EDFEKYKSGIYRH-IAGRSKGGHAVKLIGWGTERGTP 287

  Fly   301 YWILKNWWGQNWGENGYIRIRKGVNMCGI 329
            ||:..|.||..|||:|..||.:||:.|||
 Worm   288 YWLAVNSWGSQWGESGTFRILRGVDECGI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458
Peptidase_C1A 128..336 CDD:239068 68/224 (30%)
cpr-2NP_507186.3 Peptidase_C1A_CathepsinB 84..323 CDD:239111 68/224 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161043
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.