DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsL4 and C32B5.13

DIOPT Version :10

Sequence 1:NP_609387.1 Gene:CtsL4 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_493866.1 Gene:C32B5.13 / 183116 WormBaseID:WBGene00016306 Length:150 Species:Caenorhabditis elegans


Alignment Length:149 Identity:42/149 - (28%)
Similarity:72/149 - (48%) Gaps:19/149 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 ILSLSKQQIVDCSVSHGN--QGCVGGSLRNTLSY-LQSTGGIMRDQDYPYVARKG-KCQFVPDLS 231
            :||.|:|||:||    ||  ..|    ..|.||: .....|::.:.|||||.::. ||::..:..
 Worm    10 VLSFSEQQIIDC----GNFTSPC----QENILSHEFIKKNGVVTEADYPYVGKENEKCKYDENKI 66

  Fly   232 VVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYD--DPLCSSASVNHAMVV 294
            .:..|:..::....|..::..:...||....:.|.|..|. |..|||.  ...|..|:...::.:
 Worm    67 KLWPTNMLLVGNLPETLLKLFIKEHGPGYFRMKAPPSFFN-YKTGIYSPTQEECGKATDARSLTI 130

  Fly   295 IGF----GKDYWILKNWWG 309
            :|:    |::|||:|..:|
 Worm   131 VGYGIEGGQNYWIVKGSFG 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsL4NP_609387.1 Inhibitor_I29 36..96 CDD:462410
Peptidase_C1A 128..336 CDD:239068 42/149 (28%)
C32B5.13NP_493866.1 Peptidase_C1 1..150 CDD:451520 42/149 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.